(data stored in ACNUC7421 zone)

EMBL: CP001389.PE399

CP001389.PE399       Location/Qualifiers
FT   CDS_pept        455611..455964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24203"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT8"
FT                   /protein_id="ACP24203.1"
FT                   /translation="MRAADAALLDPCDKHRDEGERAFAKPNYATVVYLASERPRRCEGR
FT                   YGLGLVIMRDELGRGSPNRTRFPRERMILKKLPQKYPTAKRAAREPPFDPDGSPVLRLS
FT                   PCHIMSVPPVQRA"
     ttgcgcgccg cggacgcggc gctgctggat ccctgtgaca agcacaggga cgagggcgaa        60
     agggcattcg caaagcccaa ctacgctact gtcgtgtact tggcgtctga aagaccgcgg       120
     cgctgtgagg gccgttacgg gctcggcctt gtcatcatgc gtgacgagct cggccgaggt       180
     tcacccaatc gcactcggtt tccacgcgaa aggatgatct tgaagaaact gccgcagaaa       240
     tatccaacag caaaaagggc ggcccgagag ccgcccttcg atccggatgg atcacctgtg       300
     ctaaggctgt cgccttgtca catcatgtcc gtgccgcccg ttcagcgcgc ttga             354
//

If you have problems or comments...

PBIL Back to PBIL home page