(data stored in ACNUC7421 zone)

EMBL: CP001389.PE4

CP001389.PE4         Location/Qualifiers
FT   CDS_pept        3527..4009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00040"
FT                   /product="hypothetical protein"
FT                   /note="similar to activator of Hsp90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23808"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI5"
FT                   /protein_id="ACP23808.1"
FT                   /translation="MTAATDTRPADERDLVLIRLIDAPREKVYRAFTDPELLKQWFAPL
FT                   PWTITEAELDVRPGGTNRFVMRSPEGELYPNQGVYLEVVPNEKLVMSDAYTEAWTPSEK
FT                   PFMTAILTFEEEGGKTRYTARARHWSTADREAHEKMGFHEGWGQCADQLAALVAKL"
     atgaccgcag caaccgacac caggcccgcc gacgaacgcg acctggtcct gatccgcctg        60
     atcgacgcac cgcgcgaaaa ggtctatcgg gccttcacgg atcctgagct cctgaagcag       120
     tggttcgcac ccctgccgtg gacgatcacc gaagcggagc tcgatgtccg accgggcggc       180
     accaaccgct tcgtgatgcg ctcgccggag ggtgagcttt atcccaatca gggtgtctat       240
     ctggaggtcg tgccgaacga gaaactggtg atgagcgatg cctacacgga agcctggacg       300
     ccctctgaaa agcccttcat gacagcgatc ctgaccttcg aggaggaggg cggcaagacc       360
     cgctacaccg cccgcgcccg ccactggagc accgcggacc gtgaggcgca cgagaagatg       420
     ggctttcacg agggctgggg ccagtgcgcc gaccagctcg ccgcactcgt cgcaaaactc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page