(data stored in ACNUC7421 zone)

EMBL: CP001389.PE402

CP001389.PE402       Location/Qualifiers
FT   CDS_pept        458414..459241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04100"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24206"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU1"
FT                   /protein_id="ACP24206.1"
FT                   /translation="MASFNSISPEKLSRLVGTPKGPVLIDVRDEDDFTADPHLVPSSFH
FT                   RPHADAPTWADEYKGQWVVVLCKHGGKLSEGVAAWLRLAGAAAEILEGGLEGWREADLP
FT                   LVPVASLPKAAASGGSVWVTRARPKIDRIACPWLIRRFVDPHARFLYVTPAEVEAVGER
FT                   FGATPFDIEGVFWSHRGDDCTFDTMVKEFRLSFPALEHVARIVRGADTDRHDLEPQAAG
FT                   LLAVSLGLSRMYTDDLEQLEAGMTLYDALYRWARDATQEKHDWVSHGGKGKRT"
     atggcctcgt tcaactccat ttctcctgaa aagctttccc gtctcgtcgg cactccgaag        60
     ggacctgtcc tcatcgacgt gcgcgatgag gacgatttca ccgccgaccc ccatcttgtg       120
     ccgtcgtcgt tccataggcc ccatgccgat gcgcccacat gggcggacga atacaagggc       180
     cagtgggtcg tcgttctctg caagcacggc ggtaaactca gcgagggcgt tgccgcatgg       240
     ctgcggcttg ccggtgcggc tgcagaaatt ctagagggcg ggcttgaagg gtggcgcgaa       300
     gcggacctgc ctctcgtgcc ggtcgcgagc ctgccgaagg ccgctgcctc gggcggctcg       360
     gtgtgggtta cgcgagcccg gccgaagatc gaccgtatcg cctgcccatg gctgatccgc       420
     cgcttcgtcg atccgcatgc caggttcctc tacgtcacac ccgccgaggt cgaggcggtc       480
     ggcgagcgtt tcggcgcaac gccgttcgac attgaaggcg tgttctggag ccaccgcggc       540
     gacgactgca ccttcgacac gatggtcaag gaattccggc tgtccttccc cgccttggag       600
     cacgtcgccc gcattgtccg tggcgccgat acggacaggc acgacctcga gcctcaggcg       660
     gccggactgc ttgccgtttc gctaggcctg tcccgcatgt atacggacga cctcgaacag       720
     ctcgaggcag ggatgacact ttatgacgcg ctctatcgct gggcgcgcga tgccacccag       780
     gagaagcacg attgggtatc gcacggcggc aaggggaagc ggacgtga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page