(data stored in ACNUC7421 zone)

EMBL: CP001389.PE403

CP001389.PE403       Location/Qualifiers
FT   CDS_pept        459238..460596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04110"
FT                   /product="Chromate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24207"
FT                   /db_xref="GOA:C3MGU2"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU2"
FT                   /protein_id="ACP24207.1"
FT                   /translation="MNEQSSAGLAPAHPSFAEATKVWAKIGLLSFGGPAGQIALMHREL
FT                   VEERRWISESRFLHALNYCMLLPGPEAQQLATYIGWLLHGTRGGVVAGTLFVVPGFFVI
FT                   LALSSAYALFQETNWLASLFFGLKAAVLAIVIEALIRLSRRALKTGFDRVLAIVAFLAL
FT                   FAFGLPFPLVVVAAGVAGYVAARHAPARRDAAHAAKAPDLPSVIGADYPDGKPTWGRAA
FT                   AVVAVWGALWLAPFALIFATVGGKNVYTDVGVFFSQMAVVTFGGAYAVLAYVAQQAVET
FT                   YHWLQPGEMVDGLALAETTPGPLVLVLAFVGFMGAYRAPIGVDPLTSGMLGATLATWVT
FT                   FVPCFMWIFLGAPYVERLRANVALSGALSAISAAVAGVILNLAVWFGLHVLFGRVERLE
FT                   AGPLSLPYPDPTTLHPAALFLTILAAASLLWWKRGVFQTLAICAAAGWLLMLV"
     gtgaatgagc aatcatcggc gggcctcgcg cccgcccatc catccttcgc cgaggcgacg        60
     aaggtctggg cgaagatcgg cctcttgagc ttcggcggtc cggccggcca gatagcgctg       120
     atgcaccgcg agttggtcga ggagcgccgc tggatctccg aaagccgttt cctgcacgcg       180
     ctcaactatt gcatgctgct gccgggaccg gaggcgcagc aactcgccac ctatatcggc       240
     tggctgctgc acggcacgcg cggcggcgtg gtggccggca cgctctttgt cgtgcccggc       300
     tttttcgtca ttctcgcctt gtcttccgcc tatgccctgt ttcaggagac gaactggttg       360
     gcgagcctgt ttttcggctt gaaggccgcg gtgctggcga tcgtcatcga ggcgctgatc       420
     cggctttccc gcagggcgtt gaaaaccggc ttcgatcgcg tgctcgcgat cgtcgccttc       480
     ctggcgcttt tcgccttcgg cctgcctttt ccgctggtgg ttgttgcggc aggcgtcgcg       540
     ggctatgtcg ccgcccgcca tgcgccggcg cggcgcgacg ccgcccatgc ggcgaaggct       600
     cccgatcttc cttccgttat cggcgcggat tatcccgatg gcaagccgac ctggggaagg       660
     gcggcggcgg tcgttgccgt gtggggcgct ctctggctgg caccgttcgc gttgattttc       720
     gccacggtcg gagggaaaaa tgtctacacc gacgtcggcg tcttcttctc gcagatggcg       780
     gtcgtcacct tcggcggcgc ctatgccgtt ctcgcctatg tagcacagca ggcggtcgag       840
     acttatcact ggctgcagcc cggcgagatg gtggatggcc tggcgctggc ggagacgacg       900
     ccgggaccgc tggtgctcgt gctcgccttc gtcggcttca tgggggccta ccgggccccg       960
     atcggtgtcg acccgctgac atcaggcatg ctcggcgcga cgcttgcgac ctgggtcacc      1020
     ttcgttccgt gctttatgtg gatcttcctg ggcgcgccct atgtcgagcg gctgcgcgcc      1080
     aacgttgcgc tctccggcgc attgtcggcc atctcggcgg cggtcgcggg cgtcattctc      1140
     aacctcgcgg tctggttcgg ccttcacgtc ctcttcggcc gcgtcgagcg cttggaggcc      1200
     gggccgcttt cgctccccta tccggacccg acgacgctcc accctgccgc attgttcctg      1260
     accatcctgg cggccgcctc gcttctctgg tggaagcgcg gtgttttcca gacgctcgca      1320
     atctgtgccg cggccggctg gttgctgatg ctagtctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page