(data stored in ACNUC7421 zone)

EMBL: CP001389.PE408

CP001389.PE408       Location/Qualifiers
FT   CDS_pept        466496..466975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04160"
FT                   /product="putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24212"
FT                   /db_xref="GOA:C3MGU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU7"
FT                   /protein_id="ACP24212.1"
FT                   /translation="MAIGIRDAVPDDAATILRFITELATYEKAEHEVEATVELLTASLF
FT                   GPDRVSRAVICEVDGAPAGFAIWFYNYSTWQARKGLYLEDLYVTPEHRGSGAGKMLLKH
FT                   LARIAIAEGCGRFEWSVLDWNEPAIRVYEAIGAEPLSEWTRYRLVGKELEALAAS"
     atggcaatcg gcattcgcga cgcggttccg gacgatgcgg cgacgatcct gcgtttcatc        60
     accgagctcg ccacctatga gaaagccgag catgaggtcg aggcgaccgt cgagcttctg       120
     accgcgtcgc tcttcgggcc ggatcgggtc agccgtgcgg tcatctgcga ggtcgacggc       180
     gcgccggccg gcttcgccat ctggttctac aactattcga cctggcaggc ccgcaagggc       240
     ctctatctcg aggatctgta cgtgacgccc gagcaccgcg gctccggggc aggcaagatg       300
     ctgctcaagc acctggcgcg cattgcgatc gccgagggtt gcggccgctt cgagtggagc       360
     gttctcgatt ggaacgagcc ggccattcgc gtctacgagg cgatcggggc ggaaccgctg       420
     tcggagtgga cacgctatcg gctggtgggg aaggaactcg aggcgctcgc cgccagttga       480
//

If you have problems or comments...

PBIL Back to PBIL home page