(data stored in ACNUC7421 zone)

EMBL: CP001389.PE410

CP001389.PE410       Location/Qualifiers
FT   CDS_pept        467508..469331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04180"
FT                   /product="pseudouridylate synthase, subunit B protein"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24214"
FT                   /db_xref="GOA:C3MGU9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU9"
FT                   /protein_id="ACP24214.1"
FT                   /translation="MTFKDKSTGPGKGKGRKGNYSSGEKKANAARPGNAAPKADAGLDE
FT                   PQRISKILSRAGVASRRDIERMIMEGRVKLNGVVLETPVVNATLADQIEVDGHPIRGIE
FT                   RTRLWLYYKPAGLVTTNSDPEGRPTVFDNLPDELPRVLSVGRLDINTEGLLLLTNDGGL
FT                   ARALELPSTGWLRRYRVRAHGEIDQEALDRLKEGIAVDGVLYGAIEATLDRVQGSNVWI
FT                   TMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLGELPEGHVQEIRGRTLRDQLGPR
FT                   LIAESKANFDAPLYNDQPAAPEREAHNEVAPEWGKERSARREKPEDKRERALARLDTQR
FT                   DDSRSRDRRERPREKFEDRPARPPAKRSRTANVWMAPGARPVAEKKPKGAEEDTSPKPA
FT                   RRERPEGAPKTKRYGRTKDGAATKTSAKFDPDRKARPAKADARPDRAPRPPVKRADEDG
FT                   DWISASEPVRRKDEARDGGFERRRPFDSGERKSRDHGDRPPRREGSERPRGERPARAAG
FT                   DSRAFSEKPRTSRSKDDRPQGREGGDRPFGDRPRGKAPGGKPAGGKSFGQRSGGPRGGG
FT                   KPGGGKPGGGRPGGGKPGGRTGGGKPRGKGK"
     atgacattca aagacaagtc caccgggccc ggcaagggta aaggtcggaa gggcaattac        60
     tcttccggcg agaagaaggc caacgcggcg cgacccggca acgcggcgcc gaaagctgat       120
     gccggcctcg acgagccgca gcgcatctcg aagatcctgt cgcgcgccgg cgtcgcctcg       180
     cgccgcgaca tcgagcggat gatcatggaa gggcgcgtca agctcaacgg cgtcgtgctt       240
     gagacgccag ttgtcaatgc aacgcttgcc gaccaaatcg aggtcgacgg ccatccgatc       300
     cgcggcatcg agcggacgcg cctctggctc tattacaaac cggccggtct ggtgacgacc       360
     aattccgatc cggagggccg cccgacggtc ttcgacaacc tgccggacga actgccgcgc       420
     gtgctgtcgg tcggccgcct tgacatcaat accgagggcc tgctgctcct gaccaacgac       480
     gggggacttg cccgcgccct cgaattgccg tcgaccggtt ggttgcgacg ctatcgcgtc       540
     cgcgcgcatg gcgaaatcga ccaggaagcg ctcgaccggc tgaaggaggg gatcgccgtc       600
     gacggcgtcc tctatggtgc gatcgaggcg acgctcgacc gggttcaggg atcgaacgtc       660
     tggatcacca tggggctccg cgaaggcaag aaccgcgaga tcaagaacgt gctcggggcg       720
     ctcggcctcg acgtgaaccg gctgatccgc atttcctatg gcccgttcca actgggcgag       780
     ttgccggagg gccatgtcca ggagatccgg ggccgcacgc tccgggacca gctcggcccg       840
     cgtttgatcg ccgaatcgaa ggcgaatttc gacgcgccgc tctacaacga ccagccggcc       900
     gcgccggaaa gggaagccca caacgaggtc gctcccgagt gggggaagga acgaagcgcc       960
     cggcgtgaaa agcccgagga caagcgcgaa cgggcacttg cgcgccttga tacgcagcgc      1020
     gatgacagcc gttcccgcga ccggcgggaa cgtccccgcg agaagttcga ggatcgcccc      1080
     gcccggcctc cggcgaagcg cagccgaacg gcgaatgtct ggatggcgcc tggggcgcgt      1140
     ccggtcgctg aaaagaagcc gaagggggct gaggaagaca cctcgccgaa acccgcgcgt      1200
     cgcgagcgtc cggaaggtgc gccgaagacg aagcgttacg gccgcaccaa ggatggcgcc      1260
     gcgacaaaga catcggcaaa gttcgatccc gaccgcaagg cacgccctgc caaggcagat      1320
     gctcggccgg accgcgcccc gcggccaccg gtcaaacgtg ccgacgagga tggcgattgg      1380
     atcagcgcca gcgaaccggt tcgccgtaag gatgaggctc gcgacggtgg tttcgaacgc      1440
     cgccggcctt tcgattccgg cgaacggaaa tcgcgcgacc acggcgatcg cccgccgcgt      1500
     cgcgaaggca gcgagcgccc gcgtggcgaa cgtccggcgc gggccgcagg cgacagccgc      1560
     gcattttccg aaaagccacg gacaagccgc agcaaagatg atcgccctca gggccgcgaa      1620
     ggcggagatc gtccgttcgg tgatcggccg cgtggcaagg cgcccggtgg caagccggca      1680
     gggggaaagt ccttcggcca gcgctccggc ggtcctcgtg gtggcggtaa gcccggcggg      1740
     ggcaagcccg gtggcggcag gcccggagga ggtaagcccg gcggtcgcac gggcggcggc      1800
     aagccgcgcg gcaaggggaa gtaa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page