(data stored in ACNUC7421 zone)

EMBL: CP001389.PE411

CP001389.PE411       Location/Qualifiers
FT   CDS_pept        469338..469895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04190"
FT                   /product="putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24215"
FT                   /db_xref="GOA:C3MGV0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV0"
FT                   /protein_id="ACP24215.1"
FT                   /translation="MRIVGGEFRGRALATPKSNDIRPTTDRTRESLFNILSHGYPGVLD
FT                   GGRVLDLFAGTGAVGLEALSRGCRQALFVEQGVEGRGLIRVNIEALGLQGRAKIFRRDA
FT                   VDLGPVGTMEPFHLVFADPPYGKGLGERALASAAAGGWLVPGALVVLEEQADVRPQLSA
FT                   AFEPLDDRAFGDTRMHFYRFLG"
     gtgcgcatcg tcggcggaga gtttcggggc cgcgcgctcg ccacacccaa gtccaacgat        60
     attcggccga ccaccgaccg gacgcgcgag agcctgttca acatcctgag ccatggctac       120
     cccggcgttc tggacggtgg ccgcgtgctc gacctcttcg ccggtaccgg tgccgtgggg       180
     ctcgaggctc tgtcacgcgg ctgccggcag gcgcttttcg tcgagcaggg cgtcgaaggc       240
     cgcgggctca tcagggtcaa tatcgaagcg ctcggcctgc agggccgcgc caagatcttt       300
     cgccgcgacg cggtggatct cgggcccgtc ggcaccatgg aaccatttca tctggttttc       360
     gcagatcccc cctatggcaa ggggctcggc gaacgggcgc tcgcgtcggc ggctgcaggc       420
     ggatggctcg tgcccggggc cctggtggtg ctggaggagc aggccgatgt gcggccgcaa       480
     ctgtccgcag cctttgagcc gctcgacgat cgcgccttcg gcgacacgcg aatgcatttc       540
     taccgatttc ttggctaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page