(data stored in ACNUC7421 zone)

EMBL: CP001389.PE412

CP001389.PE412       Location/Qualifiers
FT   CDS_pept        469980..470864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04200"
FT                   /product="putative patatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24216"
FT                   /db_xref="GOA:C3MGV1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV1"
FT                   /protein_id="ACP24216.1"
FT                   /translation="MEQHVADRRDRSDTKGEPMIAVAFGGGGARGLAHIHVIEALDEMG
FT                   IRPSAIAGSSIGAIMGAGMAAGMTGREIRDYTLATVGNRGEVLNRLWQLRPNSLSEAVS
FT                   SGFRFGQFNIERVLKAFLPGAIPARFSDLLIPLKVTATDYYGQSERICESGDLHKAIAA
FT                   SCALPAIFMPVKIEGRVMIDGGMYNPIPFDHLRELADIVIAVDVVGGPDGDGKTIPSRI
FT                   DSLFGASQLMMQSIIAMKMKAGAPDILLRPEVGRFRALDFLRARDVLAATASTKEQLKR
FT                   ALSERIDQWQAGR"
     atggagcagc acgtagctga tcggcgggat cggtcggaca ccaagggtga gccgatgatc        60
     gccgttgcgt ttggtggcgg cggtgcgcgc ggccttgccc acatccatgt catcgaggcg       120
     ttggacgaga tgggcatccg gccctcggca attgccggct cgtcgatcgg cgccatcatg       180
     ggcgcaggca tggccgccgg catgaccggc cgggagatcc gagactacac gcttgccacc       240
     gtcggcaatc gcggcgaggt gctcaaccgc ctgtggcagc tccgtccgaa tagtctgtcg       300
     gaggccgtct cgagcggctt ccgcttcggg cagttcaaca tcgaacgggt gctgaaagct       360
     tttctcccgg gggcgatccc agcgcgcttt tcagacctgc tgataccgtt gaaggtaacg       420
     gcgaccgatt attacgggca aagcgagcgt atctgcgaaa gcggcgacct gcacaaggcg       480
     atcgccgcgt cctgcgcgct cccggcgatc ttcatgccgg tgaagatcga aggccgcgtg       540
     atgatcgatg gcggcatgta caatccgatt ccgttcgacc acctgcgcga gctcgccgac       600
     atcgttatcg ccgtcgacgt cgtcggaggt ccggatggcg acggcaagac gataccgagc       660
     cgcatcgaca gcctgttcgg tgcgagccag ctgatgatgc agtcgatcat cgccatgaag       720
     atgaaggccg gcgccccgga tatcctgctc cgcccggaag ttggccgctt ccgcgccttg       780
     gatttcctgc gcgcccggga cgtgctcgcc gccacagcct cgacgaagga gcaactgaag       840
     cgggcacttt cggagcggat cgaccaatgg caggcggggc gttga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page