(data stored in ACNUC7421 zone)

EMBL: CP001389.PE414

CP001389.PE414       Location/Qualifiers
FT   CDS_pept        472916..474277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04220"
FT                   /product="putative Zn-dependent protease, PmbA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24218"
FT                   /db_xref="GOA:C3MGV3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV3"
FT                   /protein_id="ACP24218.1"
FT                   /translation="MKGLIMSETIDSAILEKRAAELVDRACQAGAEAADAVVVRGRSRS
FT                   VSVRLGKVEATEASESDDFSLRVFVGRRVASVSANPGFDLKVLAERAVAMAKASPEDPY
FT                   ASLADPDRLAKSYPDLDLFDMREVSSEALTEAALAAEAAALSVAGVTNSSGAGASAGMG
FT                   GLVLVTSHGFSGSYLATRFGRSVSAIAGEGTKMERDYDYDSRLYFDDLRSADDIGRVAG
FT                   ERAVARLNPRQVPTAKNVTVVFDPRMARGFVGHLAGAINGASVARKTSFLRDMMGKQIM
FT                   KAGIAVTDDPLIVRGSSSRPFDGEGVTGSKLSMVEDGVLKHWFLSTSAARELGLETNGR
FT                   GVRGGPTVNPASTNLALEPGTLSRDDLIRDVGTGFYVTELIGQGVNMVTGEYSRGASGF
FT                   WIENGELTFPVSEVTIASNLKHMFMALTPADDIDRKFGIAAPTLAVEGMTLAGT"
     atgaaaggct taatcatgtc cgagacgatc gattccgcca tcctcgaaaa acgtgccgcc        60
     gaactggtgg accgcgcctg ccaggccggt gcggaggccg ccgacgcggt cgtcgtacgt       120
     ggtcgctccc gctcggtgtc ggtgcggctc ggcaaggtcg aggcgacgga agcctccgaa       180
     agcgacgatt tttcgcttcg ggtcttcgtc gggcggcgcg tcgccagcgt ctcggccaat       240
     ccgggcttcg atctgaaggt cctggcggag cgcgcagtcg cgatggccaa ggcttcgccg       300
     gaggacccct atgcctcgct cgccgatccc gatcggttgg cgaagtccta tccggacctg       360
     gacctcttcg acatgcgcga ggtttcgagc gaagcgctga ccgaagccgc acttgccgcc       420
     gaggcggcgg cgctttcggt ggccggtgtg accaattcga gcggcgccgg cgcctccgcc       480
     ggcatgggcg gcctcgtgct ggtgacgtcg catggcttct cgggctccta cttggcgacc       540
     cggttcgggc gctcggtcag cgccatcgcc ggcgaaggca ccaagatgga gcgcgactac       600
     gactatgaca gccggctcta tttcgacgat ctgcgcagcg ccgacgatat cggacgcgtc       660
     gccggcgaac gggcggtggc gcgcctcaat ccgcgtcagg ttcctaccgc gaagaacgtc       720
     accgtcgtct tcgatccgcg catggcacgc ggcttcgtcg gtcatctggc gggcgccatc       780
     aacggcgcgt cggtggcgcg caagaccagc ttcctgcgcg acatgatggg caagcagatc       840
     atgaaggcgg gcattgccgt cacggacgac ccgctgatcg ttcgcggctc ctcctccagg       900
     cctttcgacg gcgaaggggt caccggctcg aaactgtcga tggtcgaaga tggcgtgctc       960
     aaacactggt tcctgtcgac ctctgcggca cgggaattgg ggctcgagac caatgggcgg      1020
     ggtgtgcgcg gtggcccgac cgtcaatccg gcctcgacca acctcgccct cgagccgggg      1080
     acgctttccc gcgacgatct gatccgcgac gtcggcacgg gattctatgt gaccgagctc      1140
     atcggccagg gcgtcaacat ggtgacgggc gaatatagcc gtggcgcctc cggtttctgg      1200
     atcgagaatg gcgagcttac cttccccgtg tcggaggtga cgatcgcttc caatctcaag      1260
     cacatgttca tggccttgac gccggccgac gacatcgaca ggaaattcgg tatcgccgca      1320
     ccgacgcttg ctgtcgaagg catgacgctt gccggaacct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page