(data stored in ACNUC7421 zone)

EMBL: CP001389.PE415

CP001389.PE415       Location/Qualifiers
FT   CDS_pept        474342..475160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04230"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24219"
FT                   /db_xref="GOA:C3MGV4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV4"
FT                   /protein_id="ACP24219.1"
FT                   /translation="MSEAALQTASSRNEDLKLILAAAVAAGDTALGYFRKSVDVRWKNE
FT                   GRSPVSEADLAANDILKTRLLGARPDYGWLSEETDDDATRLARDTVFVVDPIDGTRAFI
FT                   SGKDLWCVSVAVVHQGRPTAGVLYAPALGEIFEATLDGEARKNGAAIAVRDPVPDERLQ
FT                   VAMAEDLVGKLAVPYRDRLARVPHVPSLAYRLAMIADGRIDGTIVKKNAHDWDLAAADL
FT                   ILARAGGALRGLDGMPLSYNRPIVSHGVLGAGSGLALPSLLAASRPFDAH"
     atgtcagaag cagccctcca gaccgcgtcg agccgaaacg aggatttgaa gctcatcctc        60
     gccgcagcgg tggccgcagg cgatacggcg ctcggatatt tccgaaaaag cgtcgacgtt       120
     cgctggaaga atgaaggccg ctctcccgtg agcgaggccg atctcgccgc aaacgacatc       180
     ctgaagacga ggctgctcgg cgcgcggccg gattacggct ggctctccga ggaaaccgac       240
     gacgatgcga cgcggctagc gcgcgacacc gtcttcgttg tcgatccgat cgacgggacg       300
     cgcgccttca tctccggcaa ggatctctgg tgcgtcagcg tcgccgtcgt tcaccagggc       360
     cggccgacgg ccggagtgct ctatgcgccg gccctcggag aaatcttcga ggcgaccctc       420
     gacggcgagg cacgaaagaa cggcgcggcg attgccgtgc gtgaccccgt gccggacgag       480
     cggctgcagg tggcaatggc cgaggatctc gtcggcaagc tcgccgtccc ctatcgcgac       540
     aggctggcgc gcgtaccgca tgtgccgtca ctcgcctatc ggctggcgat gatcgccgac       600
     ggccgcatcg acggcacgat cgtcaagaag aacgcgcatg actgggatct ggccgccgcc       660
     gacctcattc tggcacgggc gggcggagcg ctccgtggcc ttgacggcat gccgttgtcc       720
     tacaatcgcc cgattgtcag tcatggagtc ctgggggccg gatccgggct ggcgctaccg       780
     tcattgctgg ccgcctccag gccgttcgac gcccattga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page