(data stored in ACNUC7421 zone)

EMBL: CP001389.PE416

CP001389.PE416       Location/Qualifiers
FT   CDS_pept        475219..475455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24220"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV5"
FT                   /protein_id="ACP24220.1"
FT                   /translation="MAQNTEKKQLLHLVFGGELTTLTDVQFRDLNDLDIVGIFPDYESA
FT                   HVAWKAKAQMTVDNAHMRYFIVHMHRLLDPEHD"
     atggctcaga ataccgagaa gaagcagctc ctgcaccttg tcttcggcgg cgagttgacg        60
     acgctcaccg acgtgcaatt ccgtgatctc aacgacctcg acatcgtcgg tatcttcccc       120
     gattacgaga gcgcccacgt tgcctggaag gccaaggcgc agatgacggt cgacaacgcc       180
     catatgcgtt atttcatcgt tcacatgcac cggctgctcg atccggaaca tgattga          237
//

If you have problems or comments...

PBIL Back to PBIL home page