(data stored in ACNUC7421 zone)

EMBL: CP001389.PE422

CP001389.PE422       Location/Qualifiers
FT   CDS_pept        481256..482980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04300"
FT                   /product="putative two-component sensor histidine kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24226"
FT                   /db_xref="GOA:C3MGW1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW1"
FT                   /protein_id="ACP24226.1"
FT                   /translation="MNDVASGGADISRIVLESSCDALGLALLVCGRDDTILHASASMLQ
FT                   FFPVQPHLLKPGTRLRDFLGAVYDTGLRPGTLPESSRRRANREDWIAEQMGLHWRERYE
FT                   SVERAGRTRWICLRKRRLSSGMGILSVSDVSDQKKREEQLHTDLERVELTEQILDAQPN
FT                   PICVKDRNLNYIAANKAFCAIHDVAPEAILGRSAWDVVDAELAERFEQSDRHVLATGRP
FT                   HSEAEHIVRADGSDLWVVTRKYRVGVPGRHFVVTCMNDVTDIAAWYHGAEDGGGNSGLQ
FT                   IRDYSIFTPAQNFYDPFRALNVQQLVDAGSMIETLPARGLRVLLATADREMEDRIVARL
FT                   RGSGLDACAVRNREELDAFAATAGDCGVKLDILALDTALPARDAILAGWKTCPVLEVSS
FT                   QADATTLLGEIFKACTDRHQARSHFPPADWEVSFEGDATARTSASEVEVLVAEDNQINQ
FT                   FVFAQILDGLGVSYRIAANGREAVELWQELQPSLVLMDISMPVMNGFEAAAAIRDAESQ
FT                   TGRRTPIIAVTAQALDIDLKRCEASGMDDHIMKPISPDMIEALLRKHMRPATVRLTA"
     atgaacgatg tggcgtcggg cggcgcggac atcagcagga tcgttctgga gtcgagttgc        60
     gacgcgcttg gccttgcgct gctcgtctgc gggcgggacg acacgatcct ccatgccagc       120
     gcctcgatgc tgcagttctt tcccgttcag cctcatctgc tgaagcccgg cacgcggctt       180
     cgcgatttcc tcggggcggt ctacgacacc ggtttgcgcc caggaaccct tcccgaaagc       240
     agccgtcgcc gtgcgaaccg cgaggactgg atcgccgagc aaatgggcct ccattggcgc       300
     gagcgctacg aaagcgtcga gcgggccggc cgcacacgct ggatctgcct gcgcaagcgc       360
     cgcctgtcga gcggcatggg cattttgtcg gtcagcgacg tctccgacca gaagaagcgc       420
     gaggaacagc tccataccga cctcgagcgc gtcgaactca ccgagcagat tctcgatgcc       480
     cagcccaatc ccatctgcgt caaggaccgc aatctgaact atatcgctgc gaacaaggct       540
     ttctgcgcca ttcatgacgt ggcgccggag gcgatcctcg gtcgttcggc ctgggatgtc       600
     gtggacgccg agcttgcgga acgcttcgag cagtcggatc gacatgtgct ggcgaccggc       660
     aggccgcact cggaggcgga acatatcgtc cgtgccgacg gcagcgacct gtgggtcgtg       720
     acgcgcaagt atcgcgtcgg cgtgccgggg cgccacttcg tcgtcacctg catgaacgac       780
     gtgaccgaca tagccgcctg gtatcacggc gcggaagatg gcggcggcaa ttcggggctg       840
     cagatccgcg actacagcat cttcacgccg gcccagaatt tctatgatcc gttccgggcg       900
     ttgaacgtcc agcaactcgt cgacgccggt tcgatgatcg agacgctgcc ggcccgcggt       960
     ctgcgggtgc tcctggcgac ggcggacagg gaaatggagg atcggatcgt cgcccggctg      1020
     cgcggttcgg gcctcgacgc ctgcgccgtg cgaaatcggg aagagctcga tgcttttgcc      1080
     gccaccgccg gggactgcgg cgtgaagctc gatattctgg cgctggatac cgctttgccg      1140
     gccagggacg cgatcctcgc cgggtggaag acctgcccgg tgctcgaagt ctcctcgcaa      1200
     gccgatgcga cgaccctgct cggtgaaatc ttcaaggctt gcaccgaccg gcatcaggcg      1260
     cgctcgcatt ttccgccggc ggattgggag gtctctttcg aaggggatgc gacggcccgc      1320
     acaagtgcat ccgaagtcga ggtgctcgtt gccgaggata atcagatcaa ccagttcgtt      1380
     ttcgcgcaga tactggacgg tctcggcgtc tcctatcgga ttgccgcgaa cggccgggaa      1440
     gcagttgaac tctggcaaga gctccagccg tctctcgttc tgatggacat atcgatgccg      1500
     gtcatgaacg gcttcgaagc cgcagctgcc atccgcgacg cggaaagcca gacaggacgc      1560
     cgcacgccga tcattgcggt caccgcgcag gccctggaca tcgaccttaa gcggtgcgag      1620
     gcgtcgggaa tggacgatca catcatgaag ccgatcagtc cagatatgat cgaggcgctg      1680
     ctgcggaaac atatgcgtcc cgccaccgtg cggctgacgg cctaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page