(data stored in ACNUC7421 zone)

EMBL: CP001389.PE423

CP001389.PE423       Location/Qualifiers
FT   CDS_pept        483406..484746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04310"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24227"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW2"
FT                   /protein_id="ACP24227.1"
FT                   /translation="MILAELASDRRGPDRLPFVDPLTGLGNAQQLRHKVCELAAERASD
FT                   PAPFTIGLANLDGFKPINDLFGPEAGDRILRQVAQRLTACVPEGATVIRTADDEFALVL
FT                   PLVFERKSAEKLGQMLKEILSAPFDLGDRTVRLSASFGFAVYPFAGAEFEDLLKSADTA
FT                   LYRSKRRGRGQITVYSQEIAQEMKRATQLEQALRNAIIAEEIDVHFQPIVDLRNDGVVG
FT                   FEALARWCDPEFGYVSPSVFVPLAEERGFIEALAEMLLRKAAQTALAWPKELFLSFNLS
FT                   SAQLMDPATSGRLLAIVHQVGLDPRRLELEITETAVMADADVAQKIVSELRAAGVRVSL
FT                   DDFGTGQSSLCRLRDFSFDKVKIDRAFVSRISADRASEHIVKAIVSMCEGLELEVVAEG
FT                   IEDISEVLKLKALGCGMGQGYFYGKPADAVATLRYLSDRHREPAAAR"
     atgattctcg ccgagcttgc cagcgaccgc cgcggtccgg acaggctgcc cttcgtcgat        60
     ccgttgacgg gcctgggcaa tgcacagcaa ttgcgacaca aggtatgcga gcttgccgcc       120
     gagcgcgcca gcgatcccgc cccgttcacg atcggcctgg ccaatctcga tggcttcaag       180
     ccgatcaacg atcttttcgg gccggaggca ggcgatcgca tccttcgcca ggtggcgcag       240
     agattgacgg cctgcgttcc ggaaggggcg acggtgatcc gcacggccga cgacgagttc       300
     gccctcgtgc tgccgctggt cttcgagcgc aagagcgccg agaagcttgg ccagatgctg       360
     aaggaaatcc tctctgctcc cttcgatctc ggcgaccgca ccgttcggct gtccgcctcg       420
     ttcggctttg ccgtctatcc ctttgccggt gccgaattcg aggatctttt gaaaagcgcc       480
     gacacggcgc tttaccgttc gaaacgccgc ggccgcggcc agattacggt ctactcgcag       540
     gagatcgccc aggagatgaa gcgggcgacg cagcttgagc aggctttgcg caacgcgatc       600
     atcgctgaag agatcgacgt ccacttccag ccgatcgtcg accttcgcaa cgacggcgtc       660
     gttggtttcg aagcgcttgc caggtggtgt gatccggagt tcggctacgt ctcgccgtcc       720
     gtcttcgtgc cgctggcgga ggagcgcggc ttcatcgagg cgcttgccga aatgctgctg       780
     cgcaaggcgg cacagacggc gctggcgtgg ccgaaggaat tgtttctctc cttcaacctg       840
     tcgtctgcgc aattgatgga cccggcgacg agcggccgcc tcctggcgat cgtccaccag       900
     gtcggcctcg acccgcgccg cctcgaactg gagatcaccg aaaccgctgt gatggcggat       960
     gccgatgtgg cccagaagat cgtctccgaa ttgcgggccg ccggcgtgcg cgtttcgctc      1020
     gacgatttcg gcaccggcca atcgagcctt tgccggctgc gtgatttctc cttcgacaag      1080
     gtcaagatcg accgcgcctt cgtctcgcgg atttcagccg atcgggcctc cgaacatatt      1140
     gtcaaggcga tcgtatcaat gtgcgagggc ctcgagctcg aggtggtcgc cgagggcatc      1200
     gaggacattt ccgaagtgct gaagttgaaa gcgctcggct gcggcatggg acagggctac      1260
     ttctacggca agccggccga tgcggtcgcc accttgcgct atctctcgga ccgtcaccgc      1320
     gaacccgctg cggcgcgctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page