(data stored in ACNUC7421 zone)

EMBL: CP001389.PE424

CP001389.PE424       Location/Qualifiers
FT   CDS_pept        complement(484823..485614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24228"
FT                   /db_xref="GOA:C3MGW3"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW3"
FT                   /protein_id="ACP24228.1"
FT                   /translation="MYRQVAAIWKRRQPPALDFDFFRNSFGCRTLLEYHRRGAIGSPEA
FT                   APCPTTSTKGKIDMTDKFISSVAAGALLVGVAVAPMSFAQETTTPPPAPAPETQTMEPA
FT                   APAPADQAQTPAPADKSTDMAAAGSYLTEQAEDQISANTYIGQSVYNANDESIGEINDL
FT                   IIKKEGGVAAAVVGVGGFLGIGEKNVAVPFESIEVTEQPDSDALKLTTTETAESLKGAP
FT                   EFKTKSQLMAERNAAQPVDTSTTSATGTTPAPAPAEPAPQQ"
     ttgtatcgcc aggttgcagc catttggaag cgaagacaac caccagcttt agattttgat        60
     tttttccgga acagtttcgg ctgccggacg ttgcttgagt accaccggcg cggcgcaatc       120
     gggagtcccg aggctgcgcc ttgtccgaca acgtcaacga aaggcaagat tgatatgact       180
     gacaaattta tatcttccgt tgccgccggc gcgcttctcg tgggcgttgc cgtcgctccg       240
     atgagcttcg cgcaggaaac cactacacca cctcccgccc cggctcccga aacacagacc       300
     atggagcccg cagctccggc cccggctgac caggcacaga cgccggcacc ggcagacaag       360
     tcgaccgata tggcggcagc cggttcctat ctgacggagc aggccgagga ccagatttcc       420
     gccaacacct atatcggtca gtcggtttat aacgccaatg acgaaagcat cggcgagatc       480
     aacgacctga tcatcaagaa ggaaggcggt gtcgctgctg ccgtcgtcgg cgtcggcgga       540
     ttcctcggaa tcggtgagaa aaacgtcgcg gtgccgttcg agagcatcga agtcaccgag       600
     cagcccgact ctgatgcgct gaagctgacg acaaccgaaa cggcggaatc cctgaagggc       660
     gcgccggaat tcaagacgaa gtcgcagctg atggccgaac gcaacgcggc gcagccggtt       720
     gacacatcga ccacgtcggc taccggcaca accccggcgc cggcaccggc cgaaccggca       780
     cctcagcagt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page