(data stored in ACNUC7421 zone)

EMBL: CP001389.PE43

CP001389.PE43        Location/Qualifiers
FT   CDS_pept        45743..46264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23847"
FT                   /db_xref="GOA:C3MF10"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF10"
FT                   /protein_id="ACP23847.1"
FT                   /translation="MTALDIQISVEEGDWPSEDELQGLSTRILDVTVAFLIAEEKQPFP
FT                   DDPPELSLVFTDDQSIREINAEWRNQDKPTNVLSFPAFPVTPGNMPGPMLGDIIVAYET
FT                   LEREAAEMEKPFEEHLTHLLVHGFLHLFGYDHIEDDEAERMEGLETRILARLGLSDPYG
FT                   DQPRIDSLEQ"
     atgacggctt tggacattca gatcagcgtc gaggaggggg actggccgtc cgaggacgag        60
     ctgcagggcc tttccacgcg tattctcgac gtcaccgtgg ctttcctcat tgcggaggag       120
     aagcagccgt ttccggatga cccgccggag ctgtctctgg tgtttaccga cgatcagtcg       180
     atccgggaga tcaacgccga atggcgcaac caggacaagc ccaccaatgt cctgtccttt       240
     cccgccttcc cggtaacgcc cggcaacatg ccggggccga tgctcggcga catcatcgtc       300
     gcctatgaga cacttgagcg cgaagcggct gaaatggaga agcctttcga ggagcatttg       360
     acgcatcttc tcgtccatgg attcctccat cttttcggct atgatcatat cgaagacgac       420
     gaagcggaaa gaatggaggg gttggagact cgcattttgg cgcgtcttgg cctatctgat       480
     ccctacgggg accagccccg gattgacagt ttggaacaat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page