(data stored in ACNUC7421 zone)

EMBL: CP001389.PE433

CP001389.PE433       Location/Qualifiers
FT   CDS_pept        494233..495384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04410"
FT                   /product="putative ATP-binding Mrp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24237"
FT                   /db_xref="GOA:C3MGX2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGX2"
FT                   /protein_id="ACP24237.1"
FT                   /translation="MPDVTREMVLEKLRGVRGPDMEGNIVDLGLVSDVFISDGKAYFSI
FT                   TVPADRAKELEPMRAAAERVVREIPGVKAAMVALTADRKAAPQAAPVQRPAPPSGHAHA
FT                   PRPAGGAPAKAGIPGVGAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGP
FT                   SMPRLLKISGRPQQIEGRLIRPMENYGLRVMSMGFLVDEEVAMIWRGPMIQSALLQMLR
FT                   EVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALADARKGITMFRKVE
FT                   VPVLGIVENMSYFVAPDTGNRYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGT
FT                   PLVVSDPDGEVARIYRGIAERVWEQLSAGQGSKSRAMPNIVFE"
     atgccggacg taaccaggga aatggttctt gaaaagctgc gcggcgtgcg cggcccggac        60
     atggaaggca acatcgtcga tcttggactg gtctccgatg tgttcatttc cgacggcaag       120
     gcctatttct cgatcacggt gccggccgac cgggcgaaag agctcgaacc gatgcgcgcc       180
     gctgccgaac gagtcgttcg cgaaataccg ggcgtgaagg cggccatggt cgcgctgacc       240
     gccgaccgca aggcggcgcc tcaggcggcc cccgtgcagc gaccggctcc gccgtccggc       300
     cacgcgcatg cgccgcgacc ggccggcggt gcgccggcaa aggcgggcat tccgggcgtt       360
     ggcgccatca tcgcggttgc ttccggtaag ggcggcgtcg gcaagtccac gacgtcggta       420
     aacctggcct tggcgcttca ggcgaatggt ctcaaggtcg ggctgctcga cgccgacatc       480
     tatggcccgt cgatgccgcg cctcctgaag atttccggcc gcccgcagca gatcgaggga       540
     cggctcatcc ggccgatgga aaattacggg ctgcgggtga tgtcgatggg cttccttgtc       600
     gacgaggagg tcgcgatgat ctggcgcggg ccgatgatcc agtccgctct cctgcagatg       660
     ctgcgcgagg tggcctgggg cgagctcgac gtgctcgtcg tcgacatgcc gcccggcact       720
     ggcgatgccc aactgacgat ggcccagcag gtgccgctcg ccggcgccgt tatcgtgtcg       780
     acaccgcagg acctggccct tgccgacgcg cgcaagggca tcacgatgtt tcgcaaggtc       840
     gaggttccgg tgctcggaat cgttgaaaac atgagctatt tcgtcgcccc ggacacgggc       900
     aaccgctacg acatcttcgg ccatggcggt gctcgcaagg aggccgagcg gattggcgtg       960
     cccttcctcg gagaagtccc gctcaccatg gggatccggg aaacctcgga tgcgggcacg      1020
     cctctggtgg tttccgatcc ggacggcgag gtagcgcgca tctaccgtgg tatcgccgaa      1080
     cgcgtctggg agcagctctc agctggccag ggcagtaaaa gccgcgcaat gccgaacatc      1140
     gtcttcgaat ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page