(data stored in ACNUC7421 zone)

EMBL: CP001389.PE435

CP001389.PE435       Location/Qualifiers
FT   CDS_pept        495702..496706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04430"
FT                   /product="putative magnesium/cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24239"
FT                   /db_xref="GOA:C3MHB1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB1"
FT                   /protein_id="ACP24239.1"
FT                   /translation="MVRLPKGGRMISGYCVNGEAVALSTAEPPAALRPEIVWIDLVEPT
FT                   RAEELMMEGLLGISIPTRDDLKGIEPSSRLYVEDGAVFMTASLIYRSETQIAGLTDVGF
FT                   ILSGGRLVTIRYAEPRVFGLFKAGLHRIPGGCRNGVVILTRLLETISDRTSEILEQAVD
FT                   KIDDLSIEVFGDRAAGRRRPPQLLEARLRDVAGFHRLVAKTRDSLASLSRLLTFLYTVP
FT                   EVQEDKYSRELCRSISRDIQSLSEHAAFISGNITFLLDASLGLINVEQNAIIKIFSIAS
FT                   VVLLPPTLVASVYGMNFRVMPELEWQFGYPWALAAMVLSAIIPFFFFRWKGWL"
     atggttcgcc tcccaaaagg cggccgcatg atctcaggat attgcgtcaa tggcgaagcc        60
     gtcgcgctct cgacggcgga accgcctgcc gccctgcgcc cggaaatcgt ctggatcgac       120
     ctcgtcgagc cgaccagggc cgaagaactg atgatggaag ggctgctcgg aatttccatt       180
     ccgacccggg acgacctcaa gggcatcgag ccgtcgagcc gcctttatgt cgaagacggc       240
     gccgtcttca tgaccgcctc gctgatctat cgcagcgaga cgcagattgc tggcctgacg       300
     gacgtcggct tcattctttc cggcggccgg ctggtgacga tccgctacgc tgagccgcgc       360
     gtcttcggcc tcttcaaggc tggtttgcat cggattcccg gtggttgccg gaacggcgtg       420
     gtgatcctga cccggctgct cgaaacgatc tccgaccgga cttctgaaat tctggagcag       480
     gccgtagaca agatcgacga cttgtcgatc gaggtgttcg gcgaccgcgc tgcgggccgg       540
     cgcaggccgc cgcaactgct cgaagcgcgc ctgcgcgatg tggcgggctt tcacaggctg       600
     gtggcgaaga cgcgcgacag ccttgcttcc ctgtcgaggc tgctcacctt cctctacacc       660
     gtcccggaag tgcaggagga caagtatagt cgcgagcttt gccgctcgat ctccagggat       720
     atccaatcgc tctctgaaca cgcggccttc atctccggca acatcacctt cctgctcgat       780
     gcctcgctcg gtctcatcaa cgtcgagcag aacgccatca tcaagatctt ctcgatcgct       840
     tccgtcgtac tgctgccgcc gacgctggtc gcgtccgtct atggcatgaa tttccgggtc       900
     atgccggaac tcgaatggca gttcggctat ccctgggcgc tggcggccat ggtgctttcg       960
     gcaatcatcc cgtttttctt ctttcgctgg aaaggctggc tctag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page