(data stored in ACNUC7421 zone)

EMBL: CP001389.PE436

CP001389.PE436       Location/Qualifiers
FT   CDS_pept        496722..498623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04440"
FT                   /product="potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24240"
FT                   /db_xref="GOA:C3MHB2"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB2"
FT                   /protein_id="ACP24240.1"
FT                   /translation="MSQSSAPAVHGSENARRLLALALGSIGVVYGDIGTSPLYAFREAL
FT                   RPLAHDGVTDVEIIGLISMMIWSLTIIVTIKYVLFLLRADNQGEGGTLSLLALLMKTAN
FT                   GHTWLLFFMGVAGAALFIGDAMITPALSVLSAVEGLKLVTPALSDYVVPIAVVILLLLF
FT                   AVQSKGTAAVSNFFGPITLVWFLVMGGIGLVHIADDLSIFSAFNPFYAATFLFNEGYVG
FT                   VIVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFVIVFPALTLNYLGQGAFILEHPEAM
FT                   SDPFFLMFPKWALLPVVILATAATIIASQAVITGAFSLTRQAIHLGFLPRMAIFHTSET
FT                   HTGQIYLPNVNTLLMFGVMALVFVFGSSEALATAYGISVTGAMVVTTLLAFEFLRARWN
FT                   WSAWWAAAALLPLLALEFVFLGANMLKIHDGGYVPILIAATFIIVMWTWKRGTQILHAK
FT                   TRHIDIPLASFIKSIERKSEHAPVAVPGTAIFLTSDPDSTPAALLHNIKHNHVLHQQNF
FT                   ILTVRTANTPKVPKEERVSVRPLSERFTLLEMKFGYMETQNVSQALGLFRKSGLKFDIM
FT                   STSFYLGRRKLVPDAQSGMPHWQDRLFIALANAAIDPSDYFRLPTNRVVELGSHVII"
     atgtctcaat cgtctgcgcc tgccgtgcat ggatctgaaa atgcgcgccg cctgcttgcc        60
     ttggcgctcg ggtccatcgg cgtcgtctat ggcgacatcg gcacgagccc gctctacgct       120
     tttcgcgaag cgctgcgccc gcttgcgcat gacggcgtga cggatgtgga gatcatcggc       180
     ctcatctcga tgatgatctg gtcgctgaca atcatcgtga cgatcaaata cgtgctcttc       240
     ctgttgcggg ccgacaacca gggcgagggc gggacgctct cgctgctggc cctgctgatg       300
     aagacggcca atggccacac atggcttctg ttcttcatgg gggtcgccgg agcggctctc       360
     ttcatcggcg acgcgatgat cacgccggcg ctctcggttc tctctgctgt cgagggcctg       420
     aagctggtga cgccggcgct gtcggactat gtcgtcccga tcgcggtcgt catcctgctg       480
     ctcctgtttg ccgtgcaatc gaaggggacc gccgccgtct ccaatttctt cgggccgatc       540
     acgctcgtct ggttcctggt catgggcggc atcggcctcg tccacatcgc cgacgatctg       600
     tcgatcttct ccgctttcaa cccgttctac gccgcaacct tcctgttcaa cgaaggctat       660
     gtcggcgtca tcgtgttggg cgccgtgttc ctgacggtga ccggcgccga agcgctctat       720
     gccgacctcg gccatttcgg ccgacggccg atccaatggg cctggttcgt catcgtcttt       780
     ccggctctca ccctgaacta tctcggccag ggggccttta tcctcgagca ccccgaggcg       840
     atgtccgacc ctttcttcct gatgttcccg aagtgggcgc tgcttcccgt cgtcattctg       900
     gcgacggcgg cgaccatcat cgccagccag gccgtcatca ccggtgcttt ctcgctgacg       960
     cgccaggcga tccatctcgg cttcctgccg cgcatggcga ttttccacac gtcggagacc      1020
     catacggggc agatctacct gccgaacgtc aacacgctgc tgatgttcgg cgtcatggcg      1080
     ctggtcttcg tcttcggttc ttccgaagcg ctcgccaccg cctacggcat ctcggtcacc      1140
     ggtgccatgg tggtgacgac gttgctcgct ttcgagttcc tgcgcgcgcg ctggaactgg      1200
     tcggcctggt gggccgccgc cgcgctgctg ccgctcctgg cgctggaatt cgtcttcctc      1260
     ggcgctaaca tgctgaagat ccacgatggc ggttatgtgc cgatcctgat cgcggcgacc      1320
     ttcatcattg tcatgtggac ctggaagcgc ggcacccaga tcctccacgc caagacgcgt      1380
     cacatcgaca ttcctttggc aagcttcatc aagtcgatcg aacgcaagag cgagcatgcg      1440
     ccggtcgccg tgcccggtac ggcgatcttc ctgacgagcg acccggattc gacgccggcc      1500
     gcgctgctgc acaacatcaa gcacaaccac gtcctgcacc agcagaactt cattctgacg      1560
     gtccgcaccg ccaacacccc gaaggtgccg aaggaagagc gcgtcagcgt ccggccgcta      1620
     tcggaacgct tcaccctgct cgagatgaag ttcggctata tggagaccca gaacgtctcg      1680
     caggcgctcg gcctcttccg caagtcgggt ctgaagttcg atatcatgtc gacatccttc      1740
     tatctcggcc gccgcaagct cgtgcccgat gcccagtccg gcatgccgca ctggcaggat      1800
     cgcctgttca tcgcgctcgc caacgccgcc atcgatccct ccgactattt ccgcctgccg      1860
     accaaccgcg tcgtcgaact cggttcccac gtgatcatct ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page