(data stored in ACNUC7421 zone)

EMBL: CP001389.PE44

CP001389.PE44        Location/Qualifiers
FT   CDS_pept        46261..47421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00440"
FT                   /product="putative hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23848"
FT                   /db_xref="GOA:C3MF11"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF11"
FT                   /protein_id="ACP23848.1"
FT                   /translation="MSDFKTQPATVASEEADASGDADAGSSSTTARPEGSKPISSFWSR
FT                   AARLWRGAGASSLREDLADALMTDADSNTAFSPEERAMLNNILRFREIRVEDVMVPRAD
FT                   IEAVDQSITLGELMVLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTRQARNRRRNG
FT                   KAPHAVGADRAEKSPRQPRPGFDLSRVDLNKTVEEVSIIRQVLFVPPSMLASDLMQRMQ
FT                   AARIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDDEVMFARTSDDVFVADARVE
FT                   LEEIAEAIGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQILDADPRR
FT                   VKRVRIMRKRPPARRRVVKPEKETLPDALPANGGAQANASPPTTAE"
     atgagcgact tcaagacaca gccggcaacg gttgccagcg aggaggccga tgcctccggc        60
     gacgccgacg cgggcagtag tagtaccacc gcccgaccag agggcagcaa acccatctca       120
     tccttctgga gccgtgcggc ccgcctgtgg cgcggtgcgg gtgcgtcgag tctgcgcgag       180
     gatctcgccg acgcgctgat gacggatgcc gacagcaaca ccgcgttttc gcccgaggag       240
     cgggcgatgc tcaacaacat cctccgcttc cgggaaatcc gcgtcgagga tgtgatggtg       300
     ccgcgtgccg atatcgaagc ggtggatcaa agcatcacgc ttggagaact catggttctc       360
     ttcgaggaat ccggacgctc ccgcatgccg gtctacagcg agggtctcga cgacccgcgc       420
     gggatggtcc atatccgcga cctgcttgcc tatgtgaccc ggcaggcccg caaccgccgc       480
     cgcaacggca aggcgccgca cgccgtgggc gccgacaggg cggagaagtc accgcgccag       540
     ccgagaccgg gtttcgatct gtcgcgcgtc gatctgaaca agacggtcga agaggtgagt       600
     atcattcgcc aggtcctctt cgttccccct tcgatgctgg cctccgacct catgcagcgc       660
     atgcaggccg cccgcatcca gatggcgctg gtcatcgacg agtatggcgg cacggacggc       720
     cttgtctcgc tcgaggacat cgtcgagatg gtggtcggcg acatcgagga cgagcatgac       780
     gacgacgagg tgatgttcgc ccgcacgtcg gacgatgtat tcgtggcgga cgcgcgcgtc       840
     gagctcgagg agatcgccga ggcgatcggt ccggatttcg atgtgcgtga gcagctcgaa       900
     gacgtcgaca cgctcggcgg cctggtcttc gcatcgctcg gccgcattcc ggttcgcggc       960
     gaggtggtgc aggcgattcc cgggttcgaa ttccagatcc tcgacgccga tccgcgtcgc      1020
     gtgaagcgcg tccgcatcat gcgcaagcgg ccgccggccc gccggcgggt ggtcaagccc      1080
     gaaaaggaga ccctgcccga tgcgctgccg gcgaatgggg gcgctcaggc aaacgcttct      1140
     cctccgacca cggcggagtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page