(data stored in ACNUC7421 zone)

EMBL: CP001389.PE440

CP001389.PE440       Location/Qualifiers
FT   CDS_pept        501533..501760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04480"
FT                   /product="ATP synthase, subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24244"
FT                   /db_xref="GOA:C3MHB6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB6"
FT                   /protein_id="ACP24244.1"
FT                   /translation="MEAEAAKFIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADG
FT                   QFGRLVFGFAVTEALGIFSLLVALLLLFAV"
     atggaagcgg aagcagcaaa gttcatcggc gcaggtcttg catgccttgg tatggccggc        60
     acggctctcg gcctcggcaa catcttcggc agctacctct ccggcgctct gcgcaatccg       120
     tcggctgctg acggccagtt cggccgcctc gtattcggct tcgccgttac ggaagctctg       180
     ggcatcttct cgctgctcgt agccctgctc ctccttttcg ccgtctaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page