(data stored in ACNUC7421 zone)

EMBL: CP001389.PE447

CP001389.PE447       Location/Qualifiers
FT   CDS_pept        complement(507121..507663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04550"
FT                   /product="putative molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24251"
FT                   /db_xref="GOA:C3MHC3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC3"
FT                   /protein_id="ACP24251.1"
FT                   /translation="MPGIDEARPFIPVGIAVLTVSDTRTRADDKSGDTLEASIRDAGHR
FT                   LEARAIVRDDRREIYDQVKAWTLDASIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SEVFHRISYDKIGTSTIQSRATGGVANATFIFVLPGSPGACKDAWDGILKQQLDYRHMP
FT                   CNFVEIMPRLDEHLKRG"
     atgcccggca tcgacgaagc acgtcccttc attccggtcg ggatcgccgt cctcacggtt        60
     tccgatacgc gcacgcgcgc cgacgacaag tccggtgaca cgctcgaggc aagcatacgc       120
     gatgccggcc accggctcga ggcgcgcgca atcgtgcgtg acgaccgccg ggagatctac       180
     gatcaggtga aggcctggac gctggatgcg tcgatcgacg tcgtcatcac caccggcggg       240
     accggcttca ccggccgaga cgtgacaccg gaagcgctgg agccgctctt cgaaaagcgc       300
     atggacgggt tttccgaggt ctttcaccgg atctcctacg acaagatcgg cacgtcgacg       360
     atacagtcga gggcgacggg cggcgtggcc aatgccacct tcatcttcgt gctgcccggt       420
     tcgcccgggg cctgcaagga cgcctgggac gggatcctga agcagcagct cgactaccgg       480
     cacatgccct gcaacttcgt cgagatcatg ccgcggctgg acgagcactt gaaacgcggc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page