(data stored in ACNUC7421 zone)

EMBL: CP001389.PE449

CP001389.PE449       Location/Qualifiers
FT   CDS_pept        complement(508583..510403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04570"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24253"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC5"
FT                   /protein_id="ACP24253.1"
FT                   /translation="MRHNTFLRLLGGAAMLALLCVTGSHQAFAEDKAAVEDARPFDIRG
FT                   VNTFAGAFLAARTADVDRDFETATELYRIALRFEPENTEVKQRLMITLLMSGKFDEGVK
FT                   IAEALKSDPAVERITTTVRAIESIRKREYRSAQKLLNYQGPNDLDRLMSTLLSAWAKAG
FT                   QGRPKEAIAQIKALEGPEWFRVFKNYHTGAIALVAGDKTTARSRLNDAILDREGGSAAP
FT                   DTFMRAVEALARFEAREGNKQKALDTVSVGESLVNNYTPLEALRESIEKGEPQEQQVRN
FT                   AAQGAAAVLFSIGGALNREGAEDIVTLYLQTARRLDPESADILVMLGGIAENLKKQDEA
FT                   IALYKSVPAESPMRRVSELQLGLALASVGKVDEAKKHLQALIEVDPKNIRNYLAYGSVL
FT                   SDAKAYKEMGDLYDRAVEAIGPVPKRSDWTVFFQRGIAYERQKIWEKAEPSFLKALELN
FT                   PNQPQVLNYLGYSWVDMNINLDKGLEMIRKAVELKPDDGYIVDSLGWAYFRMNRFDEAV
FT                   TELERAAELMAGDPTINDHLGDAYWRVGRKLEAVFQWNQALEMKPEEAEVSKIKAKIEN
FT                   GLPALKQDVPAAADAKETLPKKPAAPDKKS"
     atgcggcata atacattcct tcgcctcctc ggcggcgcgg caatgctggc tcttctgtgt        60
     gtgaccggca gccaccaagc ctttgctgaa gacaaggcgg ctgtcgagga tgcccgacct       120
     ttcgacatca gaggcgtcaa caccttcgcc ggcgccttcc tggcggcgcg gacggccgac       180
     gtcgatcgcg atttcgagac ggcaacggaa ctctatcgca ttgcgctgag gttcgagccg       240
     gagaataccg aggtcaagca gcggctgatg atcacgctgc tgatgagcgg caagttcgac       300
     gaaggcgtca agattgccga ggcgctgaaa tccgatccgg ccgtcgagcg gatcaccacg       360
     actgtccggg ccatcgaatc gatccgcaag cgcgaatatc gcagcgccca gaagctgttg       420
     aactatcagg gtccgaacga tctcgaccgg ctgatgagca cgcttctatc cgcctgggcg       480
     aaggccgggc aagggcggcc caaggaggcc atcgcccaga tcaaggccct cgagggaccg       540
     gaatggttcc gggtgttcaa gaactaccac accggagcaa tcgccctcgt ggcgggcgac       600
     aagacgacgg cacgctccag gctgaacgat gccattctcg accgtgaggg cggcagcgcc       660
     gcgccggata cgttcatgcg cgcggtcgag gcgctggcgc gcttcgaagc ccgcgagggc       720
     aacaagcaga aggcgctcga tacggtttcc gtcggcgaga gcctcgtcaa caactacacg       780
     ccgctcgagg ctctgaggga gagcatcgaa aagggcgagc cccaggagca gcaggtccgc       840
     aatgccgcgc aaggggctgc cgccgtcctc ttttcgatcg gcggcgcgct caaccgcgag       900
     ggagcggaag acatcgtcac gctctatctg cagacggcgc gccgcctcga tccggaaagc       960
     gccgacatcc tggtcatgct cggcggcatc gcggaaaacc tgaagaagca ggacgaggcg      1020
     attgcgcttt acaagagcgt gccggcggaa tcgccgatgc gccgcgtctc cgagctccag      1080
     ctcggcctgg cgctcgccag cgtcggcaag gtcgacgagg cgaagaaaca cctgcaggcg      1140
     ctgattgaag tcgatccgaa gaacatccgc aactatctcg cctatggcag cgtcctttcc      1200
     gacgccaagg cgtacaagga gatgggtgac ctctacgacc gcgccgtcga ggcgatcggc      1260
     ccggtgccga agcgcagcga ctggacggtg ttcttccagc gggggatcgc ctacgaacgg      1320
     cagaagatct gggaaaaggc tgagccgagc ttcctcaagg cgctggaact caaccccaat      1380
     cagccccagg tcctgaacta tctcggctac tcttgggtcg acatgaacat caatctcgac      1440
     aagggcctgg agatgatccg caaggcggtc gagctcaagc ccgacgacgg ctacatcgtc      1500
     gattcgctcg gatgggccta tttccgcatg aaccggttcg acgaggcggt gaccgagctg      1560
     gagcgcgccg ccgaactgat ggccggcgac ccaacgatca acgaccatct tggcgatgcc      1620
     tattggcggg tcggacgcaa gctcgaagcg gtcttccagt ggaaccaggc gctcgaaatg      1680
     aagcccgagg aagcggaagt ttcgaagatc aaggcgaaga tcgagaacgg cctgccagca      1740
     ctcaagcaag acgtgccggc cgcggcggat gccaaggaga cgctgccgaa gaagcccgcc      1800
     gcgccggaca agaaatcctg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page