(data stored in ACNUC7421 zone)

EMBL: CP001389.PE45

CP001389.PE45        Location/Qualifiers
FT   CDS_pept        complement(47425..48000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23849"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF12"
FT                   /protein_id="ACP23849.1"
FT                   /translation="MFDSREKIALFIDGANLYATSKSLGFDIDYRKLLSAFQKRAYLVR
FT                   AYYYTALIEDLEFSSIRPLIDWLDYNGYTVVTKPAKEFTDALGRRKIKGSMDVELAIDA
FT                   LEQRQVVDHYVLFSGDGNFTTLVAALQRNGRKVTVVSTLSTQPPMIADELRRQADHFID
FT                   LIALRSEIDRHPQAAPQTVKPADESVNS"
     atgttcgatt cccgcgaaaa gatcgcgctt ttcatcgacg gcgccaatct ctacgcgaca        60
     tcgaagagcc tgggcttcga catcgattac cggaagctgt tgagcgcctt tcagaaacgc       120
     gcctatctgg tgcgagccta ttattacact gcccttatcg aagacctcga attttcctcg       180
     atccggccgc tgatcgactg gctggactac aatggctaca cggtcgtgac caaaccggcc       240
     aaggagttca cggacgcctt gggccggcgc aagatcaagg gcagcatgga tgtcgagctg       300
     gcgatcgatg cgctggagca gcgccaggtc gtcgaccact acgtcctctt ctccggcgac       360
     ggcaatttca ccacgctcgt ggcagcgctg cagcgcaacg gccggaaggt caccgtcgtc       420
     tcgacgcttt cgacccaacc gccgatgatc gccgacgagc tgcgccgcca ggccgaccat       480
     ttcatcgacc tcatcgcgct gcgcagcgag atcgatcgtc atccacaggc ggcaccgcag       540
     acggtcaagc cggccgacga aagcgtcaat tcctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page