(data stored in ACNUC7421 zone)

EMBL: CP001389.PE452

CP001389.PE452       Location/Qualifiers
FT   CDS_pept        511970..512743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04600"
FT                   /product="putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24256"
FT                   /db_xref="GOA:C3MHC8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC8"
FT                   /protein_id="ACP24256.1"
FT                   /translation="MTTTAESVDSFHRGKFHLIQPLGQGHRSGMDAMLLAALVSCERPC
FT                   RVADLGAGAGAAGMAVASRLAEAEVLLVERSAIMADFARRSLALPENARFASRVAVLEA
FT                   DVSLNGKARAAVGLPDDAFDHVIMNPPFNDAADRRTPDSLKAEAHAMSDDLFETWIKTA
FT                   GAIMKPGGQLSLIARPESIAEIIAACGRRFGGIEITPLLPRAGENAVRILVTAIKQSRK
FT                   RLVLRAPLIMHAEGTHRFSPEIDDLNNGREAYRRR"
     atgacgacga cggcggaatc ggtggattcg tttcatcgcg gcaaatttca tctgatccag        60
     ccgctcggcc agggccatcg ctccggcatg gacgcgatgc tgcttgccgc gctcgtgtcg       120
     tgcgagcggc cctgccgcgt tgccgatctc ggtgcgggcg cgggcgcggc cggcatggcg       180
     gtcgcctcgc ggcttgccga agccgaggtc ctgctcgtcg agcgctcggc gatcatggcc       240
     gactttgccc gccgcagcct tgccttgccg gagaacgcgc gcttcgcctc gcgggtcgcc       300
     gtgctcgagg cggatgtttc gctgaacggc aaggcgcgtg ctgcagtcgg actgccggac       360
     gacgccttcg atcacgtcat catgaatcca cccttcaacg acgccgccga ccgcaggacg       420
     ccggatagcc tcaaggccga ggcgcatgcg atgagcgacg atctcttcga gacctggatc       480
     aagacggccg gggcgatcat gaagccgggc gggcagcttt cgctgatcgc ccggccggaa       540
     tcgatcgccg agatcatcgc ggcctgcggc cgccgcttcg gcggcatcga gatcacgccg       600
     ctcttgccgc gtgccggcga gaatgccgtc aggattctgg tgacggcaat aaaacagagt       660
     cgcaagcggc tggtgctccg ggcgccgctg atcatgcacg cggaaggcac gcaccgtttc       720
     tcgccggaga tcgacgacct caacaatggc cgcgaggctt atcgccgccg gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page