(data stored in ACNUC7421 zone)

EMBL: CP001389.PE454

CP001389.PE454       Location/Qualifiers
FT   CDS_pept        513831..514022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24258"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD0"
FT                   /protein_id="ACP24258.1"
FT                   /translation="MPQIILLLIVALIAWIGYRKFIADAQKVTRHQERLRRERETGANG
FT                   TLVKDPKTGEYRLKREDE"
     atgccgcaga tcattctgct cttgatcgtc gccctcattg cctggatcgg ctatcgcaag        60
     ttcatcgccg atgcccaaaa ggtgacgcgt caccaggaac gcttgcgccg ggagcgcgaa       120
     accggcgcca acgggacgct cgtcaaggat ccgaaaaccg gagagtatcg cctgaagcgc       180
     gaggacgagt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page