(data stored in ACNUC7421 zone)

EMBL: CP001389.PE456

CP001389.PE456       Location/Qualifiers
FT   CDS_pept        515172..515711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24260"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD2"
FT                   /protein_id="ACP24260.1"
FT                   /translation="MLHAEEFAAFEPPHRFQRHGGADRQFAGIDLQGAANAGWPLDRCC
FT                   ARMGSEEGREGDNVDEGGERSHGPVCMLWLFDCLSIGHKCRSRRYRRNSSALAKWDRLQ
FT                   RLDTAAAISRPGVLTVERVDHGWLRIEAGKDMLFAGASCISHAESVLTSGGFRRRAFHD
FT                   RAGNRGRRDPLPGFRL"
     atgctgcatg cagaagaatt cgctgccttc gagccgccac atcggttcca gcgtcatgga        60
     ggcgctgatc gacaattcgc cggcatagat ttgcagggcg cggcgaatgc cggttggcct       120
     ctcgaccggt gctgcgctcg catgggcagt gaagagggcc gtgaaggcga caacgttgat       180
     gagggtggcg agcgaagtca tggtcctgtc tgcatgttgt ggttgtttga ttgtttgagt       240
     atcggccaca agtgccgatc gcgccgttac cggcggaaca gctccgcgct ggcgaaatgg       300
     gaccggcttc aacgcctcga tacggcggcc gcgatatcgc ggccaggagt actaacggtt       360
     gagcgggttg atcacggatg gcttcgaatc gaagcgggga aagatatgct tttcgccggc       420
     gcgtcctgta tctcgcacgc ggagtcggtg ctaacctccg gcgggtttcg aaggagggca       480
     tttcatgatc gggctggcaa tcggggtcgc cgtgatcctt tacctggttt tcgtctataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page