(data stored in ACNUC7421 zone)

EMBL: CP001389.PE457

CP001389.PE457       Location/Qualifiers
FT   CDS_pept        515656..516204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04650"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24261"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD3"
FT                   /protein_id="ACP24261.1"
FT                   /translation="MIGLAIGVAVILYLVFVYNGLVKARQMAEEAWSGIDVQLKRRADL
FT                   IPNLIETVKGYAAHEKSTLEEVVALRNRAQAVPEGDIAARAAAEGALSQALGRLFALAE
FT                   AYPDLKANENFVELQRSLETIEGEIQMSRRYYNGAARDLNVKVESFPSNLIAGTFRFAK
FT                   ASYFEITNEADRAVPSVKF"
     atgatcgggc tggcaatcgg ggtcgccgtg atcctttacc tggttttcgt ctataacggc        60
     ctcgtcaagg cgcgtcagat ggccgaagag gcctggtccg gcatcgacgt gcagttgaag       120
     cgccgcgccg atctcatccc caacctgatc gagactgtga agggctatgc ggctcacgag       180
     aagtcgacgc tcgaggaagt cgtcgccttg cgcaaccggg cccaggccgt ccccgagggc       240
     gacatcgccg cacgggccgc cgccgaaggg gcactctcgc aggcgcttgg ccggctcttc       300
     gcgctcgccg aagcctatcc ggatctgaag gccaacgaga attttgtcga gctccagcgc       360
     tcgctggaaa cgatcgaggg cgagatccag atgtcgcgcc gctactacaa cggtgctgcc       420
     cgcgatctca acgtcaaggt cgaaagcttc ccgtccaacc tgatcgccgg caccttccgc       480
     tttgccaagg ccagctattt cgagatcacc aacgaagcgg atcgcgctgt gccgtcggtc       540
     aagttctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page