(data stored in ACNUC7421 zone)

EMBL: CP001389.PE458

CP001389.PE458       Location/Qualifiers
FT   CDS_pept        516229..518166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24262"
FT                   /db_xref="GOA:C3MHD4"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD4"
FT                   /protein_id="ACP24262.1"
FT                   /translation="MKRLLAALAFVLMVLAAPCPAAAEEIISSYHSVIDVAKDGTLTVT
FT                   ETITANVEGNQIRRGIYRDFPLTFIDPDGRRVRVDFKLVSVERDGEQEEYRTESISGGI
FT                   RIYTGNADVFLPRGEHIFQLTYETSRQIRFFNDHDELYWNVTGTEWAFPIEEATATVTL
FT                   PDGVVAQALDVFTGGYGATGKDARAVEEGGEIFFATTRRLRPQEGLTIAIKLPKGSIDR
FT                   PSPSQQNIWWLRDHLAVVIAGAGLVAVGLYYGRAWVRVGRDPARGVMVPRWDPPDGISP
FT                   ALVNYIDNKGFSGEGWTALSAAALSLAVKGYVVLDDLKNAIIVSATGKSGGEKLPTGEA
FT                   ALMKSVEAAGGTLKIDRANGKAVADAGSSFRSAMEREHRGKYYQANVGYITGGVVLSIV
FT                   ALAALFIFGELGEETIPFIVVPVFVAVFVSGFAVSVGKSLRRGSSLMRRIMSIVVLAFI
FT                   GFVLVAVFSSILAVVMFSATEPDDLPLFFAVGGIVLVNGLFYYLMGAPTPLGTRMMDGI
FT                   DGLRQYLTLAEQDRLNMQGVPEMSPRHFETLLPYAVALGVEKPWTETFDRWLLAAAGGA
FT                   AAAAYQPSWYHGDSFGPGSFSDTIGGFAGSMADTMTSSLPPPPKSSSSGFSSGGGFSGG
FT                   GGGGGGGGGW"
     atgaagcggc ttctggcggc gcttgcgttc gtgcttatgg tccttgccgc accgtgcccg        60
     gctgcggcgg aagagatcat ttcttcctac cattcggtca ttgatgtggc caaggacggc       120
     acgctcacgg tcaccgaaac gatcaccgcg aatgtcgaag gcaaccagat tcgccgcggc       180
     atctatcgtg attttccgct gaccttcatc gacccggacg gccggcgcgt ccgggtggat       240
     ttcaagctcg tctccgtcga acgtgatggc gagcaggagg aataccggac cgaatcgatc       300
     agtggcggca tccgcatcta caccggcaat gccgacgtgt tcctgccgcg cggcgagcat       360
     atatttcagc tcacctatga gaccagccgc cagatacgct tcttcaacga tcacgacgag       420
     ctctactgga acgtgaccgg caccgaatgg gcgttcccga tcgaggaggc gaccgccacc       480
     gttaccttgc cggatggcgt ggtggcgcag gcgctcgacg tctttaccgg cggctacggc       540
     gccaccggca aggacgcgcg cgccgtcgag gaggggggcg agatcttttt cgccacgacg       600
     cgccggcttc gcccgcagga gggcctcacc atcgcgatca agttgccgaa aggcagcatc       660
     gatcggccga gtccctcgca gcagaacatc tggtggctgc gcgaccacct ggcggtggtc       720
     atcgccggcg ccggcctcgt cgccgtgggc ctttattacg ggcgtgcctg ggtgcgggtc       780
     ggtcgcgacc ccgcccgcgg cgtcatggtg ccgcgctggg acccgccgga cggcatttcg       840
     ccggcgctgg tcaactatat cgacaacaag ggcttttccg gtgagggctg gactgcgctc       900
     tcggccgcgg cgctcagtct cgcggtgaag ggatatgtcg tcctcgacga tctgaagaat       960
     gccatcatcg tctcggcgac cggcaaaagc ggtggcgaaa aacttccgac cggcgaggcg      1020
     gcgctgatga agtcggtcga ggccgctggt ggaacgctca aaatcgatcg ggcgaacggc      1080
     aaggcggttg ccgacgccgg atccagcttc cgcagcgcca tggagcgcga gcatcgcggc      1140
     aaatactacc aggccaatgt cggctacatc accggcggcg tcgtgctttc gatcgtagcg      1200
     ctggcagcgc ttttcatctt cggcgagctc ggagaagaga cgattccttt catcgtcgtc      1260
     ccggtcttcg tcgccgtatt cgtttccggc ttcgccgttt cggtcggcaa gtccctgagg      1320
     cgcgggtcga gcctcatgcg ccgcatcatg tcgatcgtcg tgctggcctt catcggcttt      1380
     gtgctggtcg ccgtcttttc gagcatcctg gcggtggtca tgttctcggc aacggagccg      1440
     gacgacctgc cgctgttctt cgcggtcggc ggcatcgtgc tcgtcaacgg gctcttctat      1500
     tacctgatgg gggcgccgac accgcttggc acccggatga tggatggcat tgacgggctc      1560
     cggcaatatt tgacgcttgc ggaacaggat cgtctgaaca tgcagggcgt gccggaaatg      1620
     tcgccgcggc atttcgaaac gctgttgccc tatgccgtcg cgctcggcgt cgaaaagccc      1680
     tggaccgaga ccttcgatcg ctggctgctg gcggcagccg ggggtgcggc agccgccgcc      1740
     taccaaccga gctggtacca tggcgatagc ttcggcccgg gatccttctc cgacacgatc      1800
     ggtggcttcg ccggatcgat ggccgacacg atgacctctt cgctgccgcc tccgcccaag      1860
     agttcgtcct ccggcttttc gtccggtggc ggcttttccg gtggcggtgg cggtggcggt      1920
     ggtggcggcg gctggtag                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page