(data stored in ACNUC7421 zone)

EMBL: CP001389.PE461

CP001389.PE461       Location/Qualifiers
FT   CDS_pept        521440..521820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24265"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD7"
FT                   /protein_id="ACP24265.1"
FT                   /translation="MNLSSRTYAPINFADKLAKFADQWQPRVIAELNDYQFKIVRIEGD
FT                   FIWHDHPETDEAFIVLEGTLRIDFREGSVTLGPGEMYVVPKGVEHKPFAASEVKMLLIE
FT                   PAGTLNTGQAGGERTAASDVWI"
     atgaatctgt ccagccgcac ctacgccccg atcaatttcg ccgacaagct ggcgaaattc        60
     gccgaccagt ggcagccacg ggtgatcgcc gaactcaatg actaccagtt caagatcgtc       120
     cgcatcgaag gcgacttcat ctggcacgat catccggaaa cggacgaggc cttcatcgtt       180
     ctcgagggca cgcttcggat cgattttcgc gagggctccg tgacactcgg cccaggcgaa       240
     atgtacgtcg tgcccaaggg cgtcgagcac aagccctttg cggcaagcga agtgaagatg       300
     ctgctcatcg agcctgcggg tacgctgaac accggccagg cgggcggtga acgcactgct       360
     gcgagcgacg tctggatctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page