(data stored in ACNUC7421 zone)

EMBL: CP001389.PE463

CP001389.PE463       Location/Qualifiers
FT   CDS_pept        522047..522427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24267"
FT                   /db_xref="GOA:C3MHD9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD9"
FT                   /protein_id="ACP24267.1"
FT                   /translation="MAATVIGGLYMLYLALRIATAPPVAAEQGTHLPSFLGGFVLAIAN
FT                   PKAYAAIGSLYVGSLVDAQQGTRAAVGSVVVLAFVAVALNTTWLAFGAAIAAVLRDPRK
FT                   ARIANLVFALLLLASLVPLLLS"
     atggcggcga cagtcattgg cgggctctac atgctgtacc tcgccttgcg cattgcgacc        60
     gcgccgccgg tcgccgctga gcaaggaacg catcttccgt cattcctcgg cggctttgtc       120
     ttggcgatcg ccaatccgaa ggcctatgcg gcgatcggct cgctctatgt gggaagcctg       180
     gtagacgctc agcagggaac ccgggcggcc gtcgggagtg tcgtggtcct ggccttcgtc       240
     gcggtcgccc tgaacaccac ctggcttgcc ttcggtgccg ccatcgcagc ggtccttcgt       300
     gatccgagaa aggcgcggat cgccaacctt gtcttcgcac ttctgctgct tgcctcactc       360
     gttccgctgc tgctcagctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page