(data stored in ACNUC7421 zone)

EMBL: CP001389.PE464

CP001389.PE464       Location/Qualifiers
FT   CDS_pept        522473..522979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24268"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE0"
FT                   /protein_id="ACP24268.1"
FT                   /translation="MTAKILVSACLMGHAVRYDGAAKPLCHPALERWRAEGRLVTLCPE
FT                   MSAGMPVPRPPAEIEAGKTGASILSGSGRVLEKTGSDVTEAFRHGAENALALARATNCR
FT                   FALLIDGSPSCGSSLVYDGSFNGERVRGEGVTAALLRRNGIEVFSDREVDMLVERLARD
FT                   DEAAP"
     atgaccgcca agatcctcgt cagcgcctgt ctcatgggcc atgcggtgcg ttacgatggc        60
     gccgcgaaac cgctctgcca tccggcgttg gaacgttggc gcgcggaagg gcggctcgtg       120
     accctctgtc ccgaaatgtc ggcgggcatg ccggttccgc ggccgccggc ggagatcgag       180
     gcaggcaaga ccggcgcgag catcctttcc ggctccggcc gcgtcctcga aaagaccggc       240
     agcgatgtga cggaggcatt tcgccatggc gcggagaacg cgcttgctct cgcacgcgcg       300
     acgaactgtc gtttcgcgct gctgattgac ggcagcccgt cctgcggctc cagccttgtc       360
     tatgacggca gcttcaacgg cgaacgcgtt cggggcgagg gtgtcaccgc agcgctcctt       420
     cgccggaacg gcatcgaggt cttttccgac cgcgaggtcg atatgctggt agagaggctt       480
     gcccgcgacg acgaggctgc cccataa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page