(data stored in ACNUC7421 zone)

EMBL: CP001389.PE465

CP001389.PE465       Location/Qualifiers
FT   CDS_pept        complement(523088..523585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24269"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE1"
FT                   /protein_id="ACP24269.1"
FT                   /translation="MRSLLITAALTLAAGTATASSVEDVASGQAVNASVATISCAECPP
FT                   LQPKKKASYVVPELAPGTAKLEVKEINGEMKSVRTEAWLGGSPVVFVNKASEEAIKAAA
FT                   IKADPASAGAAEASVAAVADIDQTAKTAAVGIVSHAEPVSASMAGSGSQEFDPSGFELR
FT                   LD"
     atgcgttccc tgctgatcac cgccgccctg acgcttgccg ccggcaccgc cacagcgtcg        60
     tcggtcgagg acgtagcgtc cggacaggcc gtcaatgcca gcgtcgcgac gatttcctgc       120
     gcagagtgcc cgccgctgca gcccaagaag aaggcctcct atgtggtgcc cgagttggcg       180
     cccggcaccg ccaagctcga agtcaaggag atcaatggcg aaatgaagtc ggtgcgcacc       240
     gaagcgtggc tcggaggatc gccggtggtc ttcgtcaaca aggcttccga ggaagcgatc       300
     aaggcagccg cgatcaaggc ggatccagcg tcggcgggtg ccgctgaagc ctcggtcgcc       360
     gcggttgcgg atatcgacca gacggcaaag actgcggctg tcgggattgt gtcgcatgcc       420
     gaaccggtga gcgcctctat ggcaggcagc ggttcacagg aatttgatcc gtcgggcttc       480
     gaacttcgtc tggattag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page