(data stored in ACNUC7421 zone)

EMBL: CP001389.PE467

CP001389.PE467       Location/Qualifiers
FT   CDS_pept        complement(525048..527759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04750"
FT                   /product="c-di-GMP phosphodiesterase A-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24271"
FT                   /db_xref="GOA:C3MHE3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE3"
FT                   /protein_id="ACP24271.1"
FT                   /translation="MAIFGPPGRDTFLARLRFGYRRFAAQAARPGVPRFHRFAGKRRCQ
FT                   CPGLDHADHEQRGVEAPAGGDAIRPGDLSAGHDPGEKPVPAGTLNPVGPSAPTHHQHIG
FT                   EFSVTLSKRALFLIFPVVLLGYLLAALSVYFAQERSIQALEKAKLSQRLEHAGAVFQNE
FT                   VQRSKSFLNALLNGNVLRQFVAETDERYRVTALGARLQESIKSLSEDPIAYISFAILNS
FT                   KAEPEYYYENGWDPFAEIDEPQRDLARKLLAGKRLSDLTYLEPTGDRPRIVFSLFVDPV
FT                   TFGRPMPSNKANALLMQIAVLPDRFLAMQAALKKEYGADIVLQPWPLAVTDRLSAGTPL
FT                   GTQLYATIVVPDAYFEAEVLRRKVLLACGALAMSLISIFLIVLLIRRFITGPIASLDAD
FT                   VTAVMNGERDDIRDMDEAGEIGRLTHNIRELHGQSAHSLRLVQQNSWTDTLTGINNRGR
FT                   FNALAAGVVEEAVASGEKCSLLFIDIDNFKFVNDKHGHDVGDDLLKTLAVRIGQTVEAI
FT                   TRRRQLEPAILARLSGDEFAVLVRSNPGEGTIREISNAILALFDGGFEVSGKSYPVTAS
FT                   IGVAICPDDATNIAELISNADAAMYQAKSGGRNRSSRFSRALHDKRTRLRQIQEELRGL
FT                   DPDEQFRLVYMPIVNVRGQVTGCEALLRWHSPILGAVTPDEFVPIAESSGLFTKIDWWV
FT                   INKAMSDCGQLKALFGQDTVLAINISSAELHSHALGDYLSDCAARHQLEPQSIDIELTE
FT                   TFAVKISDQLRQNIDELRHKGFRLSIDDFGAGYTSIQQIIDYAADTIKLDRALVTNLTA
FT                   SHSLSVLKAVVALCHAKDMAVIGEGVDTPEKLAMLTAAGCDRFQGYLISKPLSLDDLAI
FT                   WALTRTAQHVKDRPADERSVSARRSSSREARR"
     gtggcgatat tcggtccccc gggaagggac actttcctgg ctcgactgcg tttcggttat        60
     cgccggttcg ccgcgcaagc agcacgccct ggagttcctc gatttcatcg gttcgccgga       120
     aagcgccgct gccaatgccc tggccttgac catgccgacc acgagcagcg cggcgttgaa       180
     gctcctgccg gaggcgatgc gatccgaccc ggagatctat ccgccggcca cgaccctggc       240
     gaaaagccag taccagcagg aactctcaat ccagtcggtc caagcgcgcc gacgcatcat       300
     cagcacattg gcgaattttc agtgacactc agcaagcgcg ccctcttcct tatctttcca       360
     gtagtgcttc taggctacct tctcgcagcg ctctcggtct atttcgccca ggagcgctcc       420
     attcaggcgc tggagaaggc caagctttcc caacggctgg agcatgcggg cgcggttttc       480
     cagaacgagg tccagcgcag caagagtttt ctcaacgccc tgctgaacgg caacgttctg       540
     cgccaattcg tcgccgagac cgacgagcgc taccgtgtga ccgcgctcgg cgcgcgcctg       600
     caggagagca taaaatcgct atccgaagat ccgatagcct acatctcatt tgccatcctc       660
     aactcgaaag cagagcccga gtactattac gagaacggtt gggatccctt cgccgagatc       720
     gacgaaccgc aacgcgatct tgcgagaaag ttgctcgccg gcaagcggct gagcgacttg       780
     acctatcttg agcccaccgg cgaccggccg cgaatcgtct tttccctttt cgtcgatccg       840
     gtcacctttg gccgtcccat gccgagcaac aaggccaatg cgttgctgat gcagattgcc       900
     gttctgccgg accggttcct tgcaatgcag gcagccttga agaaggaata tggcgccgac       960
     atcgttctgc aaccatggcc gcttgccgtc accgacaggc tttcggcagg cacgccgctc      1020
     gggacgcagc tctacgccac gatcgtcgtc cccgacgcct atttcgaggc tgaggtattg      1080
     cgccgaaagg tgctgcttgc ctgcggcgcc ctcgccatga gcctgatctc gatcttcctg      1140
     atcgtgctat tgatcaggcg cttcatcacg ggaccgatcg ccagtctcga cgccgacgtc      1200
     acggccgtga tgaacggcga gcgtgacgac atcagggaca tggacgaagc gggcgagatc      1260
     ggccgcctca cccacaatat ccgcgagctt catggccaat ccgcccattc cctgcggctc      1320
     gtgcagcaga actcgtggac cgacacgctc accggcatca acaaccgcgg acgtttcaac      1380
     gcgcttgcgg ccggcgtcgt cgaagaagcc gtcgcttccg gcgagaagtg cagcctgctg      1440
     ttcatcgaca tcgacaattt caaattcgtc aacgacaagc acggacacga tgtcggcgac      1500
     gacctgctca agacgcttgc ggtcagaatt ggccagacgg tcgaggccat cacccggagg      1560
     aggcagctgg agccggccat cctcgcccgc ctttccggcg acgaatttgc ggttctggtg      1620
     cgctccaacc cgggcgaagg cacgatccgg gagatctcca acgcgattct cgccctgttt      1680
     gacggcggct tcgaagtgtc cggcaagagc tatccggtga cggcaagcat cggcgtggcg      1740
     atctgcccgg atgatgccac caatatcgcc gaactgatct ccaatgcaga tgcggccatg      1800
     taccaggcga agtccggcgg caggaaccgc tcctcccgtt tctcgcgggc gctccacgac      1860
     aagcgtaccc ggctgcgcca gatccaggag gaactgcgcg ggctcgatcc cgacgaacaa      1920
     ttccgcctgg tctacatgcc gatcgtcaac gtgcggggcc aagtcaccgg ctgcgaggcg      1980
     ctgttgcgct ggcattcgcc gattctcggc gccgttacgc cggacgaatt cgtcccgatc      2040
     gccgaaagct ccggtctttt caccaagatc gactggtggg tcatcaacaa ggcgatgtcc      2100
     gactgcggtc agttgaaggc actcttcggg caggatacgg ttctggcgat caacatctct      2160
     tcagccgagt tgcattcgca cgcgctcggc gactatctgt cggattgcgc ggcccgccat      2220
     cagctcgaac cgcaatcgat cgacatcgaa ctcaccgaga cgttcgccgt caagatcagc      2280
     gaccagctca ggcagaacat cgacgagctg cgccacaagg gcttccgcct gtcgatcgac      2340
     gacttcggcg ccggctacac ctcgatccag cagatcatcg actacgccgc cgataccatc      2400
     aagctggacc gggcgctggt caccaacctc acggcctcgc actccctctc cgtcctcaag      2460
     gcggtcgtcg cactctgcca tgcgaaggac atggcggtga tcggcgaagg cgtcgatacg      2520
     ccggaaaaac tcgccatgct caccgcagcc ggctgcgacc gcttccaggg ctacctgatc      2580
     agcaagccgc tctcgctcga cgacctggcg atctgggcac tcactcggac cgcgcagcac      2640
     gtcaaggacc gtcccgccga cgagcgctcc gtcagcgccc gccggagctc gagccgggaa      2700
     gcgcgccggt ga                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page