(data stored in ACNUC7421 zone)

EMBL: CP001389.PE468

CP001389.PE468       Location/Qualifiers
FT   CDS_pept        complement(527435..528475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04760"
FT                   /product="putative spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24272"
FT                   /db_xref="GOA:C3MHE4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE4"
FT                   /protein_id="ACP24272.1"
FT                   /translation="MRRRAATSVFLATLLCAAASRAETLNLLIWEAYIDQGLIDRWTQK
FT                   TGVSIHQINFDSDDARDEVLADPSNNIDLVVVDENGAHLFGKKGVLETLNEANLPALAD
FT                   YAPEWRDRCAGSGLPYFSGTVGILYRSDVIAEPPTSWQELMRPAASLKKHVAMFDDHTE
FT                   LFVPPLMLLGASINTSDTGTLKAAFDLLKAQAPAVLTYDYVITAIQDQTSGKEIHMALG
FT                   YSGDQHVLNDKVSKPGLWRYSVPREGTLSWLDCVSVIAGSPRKQHALEFLDFIGSPESA
FT                   AANALALTMPTTSSAALKLLPEAMRSDPEIYPPATTLAKSQYQQELSIQSVQARRRIIS
FT                   TLANFQ"
     atgagaaggc gcgcggctac atccgtcttc ctggcgacat tgctttgcgc ggccgcaagc        60
     cgtgccgaaa cgctcaacct gttgatctgg gaagcctata tcgaccaggg cctcatcgac       120
     cgctggacgc agaagaccgg cgtctcgatc catcagatca atttcgacag tgacgacgca       180
     cgcgacgagg ttctcgccga tccgagcaac aacatcgatc tcgtcgtcgt cgacgagaac       240
     ggcgcgcatc ttttcggcaa gaaaggcgtt ctcgagaccc tcaacgaagc caatttgccg       300
     gcgctcgcag actacgcgcc agagtggcga gatcgctgtg ccggatctgg acttccctat       360
     ttctccggaa cggtcggcat tctctatcgc tccgatgtca tcgctgagcc gccgacatcc       420
     tggcaggaac tgatgcgccc tgcggcttcg ctcaagaagc atgtcgcgat gttcgacgac       480
     cacaccgaac tcttcgtgcc gccgctgatg ctgctcggcg cgtccatcaa taccagcgat       540
     accgggaccc tgaaggccgc cttcgatctc ctgaaggcac aagcaccggc cgtattgact       600
     tatgattatg tgatcaccgc catccaggac cagacgtccg gcaaagagat ccatatggcg       660
     ctcggctaca gcggcgatca gcacgtcctc aacgacaagg tcagcaagcc gggcctgtgg       720
     cgatattcgg tcccccggga agggacactt tcctggctcg actgcgtttc ggttatcgcc       780
     ggttcgccgc gcaagcagca cgccctggag ttcctcgatt tcatcggttc gccggaaagc       840
     gccgctgcca atgccctggc cttgaccatg ccgaccacga gcagcgcggc gttgaagctc       900
     ctgccggagg cgatgcgatc cgacccggag atctatccgc cggccacgac cctggcgaaa       960
     agccagtacc agcaggaact ctcaatccag tcggtccaag cgcgccgacg catcatcagc      1020
     acattggcga attttcagtg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page