(data stored in ACNUC7421 zone)

EMBL: CP001389.PE472

CP001389.PE472       Location/Qualifiers
FT   CDS_pept        complement(532034..532600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24276"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE8"
FT                   /protein_id="ACP24276.1"
FT                   /translation="MRNTLSQPAWVGNTLRLDPKRFPQQATYVLRGDVGNVSISLDQRG
FT                   AVLRKVLPSSGLPLSIALPARAFKGVAARAIDHGDGEVTVTLELHHDDPDLCIPLLVAH
FT                   DLSDIAADWRAWAEAYRIPMLMVEADGVARPLEEHLGEIRTAPVKPRRRHSFFAERRPR
FT                   FLVRRSTGKLGVHMKIDGREIIARS"
     atgcgcaaca cactctctca accggcctgg gtaggaaaca cgctgcggct cgatccgaag        60
     cgttttccgc agcaggcgac ctatgtcctg cgcggcgatg tgggcaatgt gagcatcagc       120
     ctcgaccagc gtggcgccgt cctgcgcaag gtgctaccat ccagcggcct gcccctttcg       180
     atcgccttgc cggcacgagc tttcaaagga gtcgcggcgc gggccatcga ccatggcgac       240
     ggggaggtaa ctgtgacgct ggagctccat cacgacgatc cggatctttg catcccgttg       300
     ctcgttgcgc acgacctttc cgacatcgcg gccgactggc gtgcctgggc cgaggcctac       360
     cgcatcccga tgctgatggt tgaggcggac ggggtcgcgc ggccgctcga agaacatctc       420
     ggcgaaatcc gcacggcacc ggtaaagccg cgccggcgcc actccttctt tgccgagcgc       480
     cgaccccgct tcctcgtgcg ccgttccacc ggcaagctcg gcgtgcacat gaagatcgac       540
     gggcgcgaga tcatcgcccg gagctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page