(data stored in ACNUC7421 zone)

EMBL: CP001389.PE473

CP001389.PE473       Location/Qualifiers
FT   CDS_pept        532929..535238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04810"
FT                   /product="putative flagella associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24277"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE9"
FT                   /protein_id="ACP24277.1"
FT                   /translation="MVSTYLDYNLIARDMKVSLKRVSEQTVVARDTQYYKENIGNVSSV
FT                   DAFLDDYRLYSYAMTAFGLGDMIDSVAFMRKVLESDLSDTSSFANSLTDDRYREFALAY
FT                   SFSGATAVSQTEAQLDEIIGLYDTSILNIAETQEEETRYYNVMIDKITSVDQLLNNDRL
FT                   RAYVFTAFGVDESTYSRQTIRSVLSSSSGDASSYENTVIAPKLSELETAKAAAEAQLTA
FT                   GGLTDEEEAELESKITTYANSIATLNNYIDLAAAFDFNSDGTVTAGAAQTDENKETTNE
FT                   LYISSNSRVTSQAALLNKAYFEETIASITTVTELLADTRLYNYIRTAFDLDEVTIVSAT
FT                   IKNILTSDPDDPDSYVNTIGGGDANYLALANAFNFQEDGTLAVGDSAQTAAQTTLTSNR
FT                   YMTRYNDKDDEADEKAVSAYKTAVASMTSVDDFIGSASIYDFALKAVGLDPDTASTRTI
FT                   KRVLTSDLTDPKSYVYSLKDERYVTLAKLFNFTTEGEIGPPALAQSETQIQETAKNHIV
FT                   IKSRFGSEDDKTKAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPEGVTADV
FT                   LRQIFNSDLDDPESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGLYETLD
FT                   QYLRQTLEEQAGESNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPDEFST
FT                   MDIDQQAKIVEKNLDLEKLSDPAELKKLLARFAVLYDLENNTEVDPAVSVLTSTGSSVG
FT                   ISADTLYTLSQLRMGG"
     atggtttcga cctatctcga ctacaatctc atcgcgcggg acatgaaggt cagcctgaag        60
     cgggtgtcgg agcagacggt cgtcgcgcgc gacacgcaat actacaagga gaatatcggc       120
     aatgtgagtt cggtagacgc gttcctcgac gactaccggc tctattccta cgcgatgacg       180
     gcctttggcc tgggggacat gatcgattcg gtcgccttca tgcgaaaggt gctcgaaagc       240
     gacctctccg acacgagcag cttcgccaac agcctgacgg acgaccgcta ccgcgaattc       300
     gccctcgcct acagcttcag cggcgcgacc gccgtctcgc agacggaggc gcagctcgac       360
     gagatcatcg gcctctacga tacgagcatt ctcaacatcg cggagaccca ggaggaggaa       420
     acccgctact acaacgtcat gatcgacaag atcaccagcg tcgatcagct tctgaacaac       480
     gacaggctga gagcctatgt cttcacggcc ttcggcgtcg acgaaagcac ctattcccgc       540
     cagacgatcc gcagcgtgct gtccagcagt tccggcgatg cgagcagcta cgagaataca       600
     gtgattgctc cgaagctctc cgaactcgag accgccaagg ccgcggcgga agcgcagttg       660
     accgccggcg gcctcaccga cgaggaagag gcggaactcg agagcaagat aacgacctac       720
     gcaaattcca ttgccacgct gaacaactat atcgacctcg ccgctgcctt cgactttaac       780
     tccgatggca cggtgaccgc gggcgccgca cagacggacg aaaacaaaga gacgaccaac       840
     gaactctata tctccagcaa ttcccgcgtt acgtcgcagg cggcgctgct gaacaaggcc       900
     tatttcgagg agacgatcgc gagtatcacg accgtcactg agctcctcgc ggatacacgc       960
     ctctacaatt acatcaggac cgctttcgac ctcgacgagg tgacgatcgt ttccgcaacg      1020
     atcaagaaca ttctgacgag cgacccggat gaccccgaca gctatgtcaa cacgatcggc      1080
     ggcggcgacg cgaactatct ggcgcttgcc aatgccttca acttccagga ggacggcacg      1140
     ctggccgtcg gcgacagcgc gcagactgcg gcgcagacga cgctcacctc caaccgctac      1200
     atgacgcgtt acaacgacaa ggacgacgaa gccgacgaaa aggcggtcag tgcctacaag      1260
     accgctgtcg ccagcatgac gtccgtcgac gatttcatcg ggtctgcgtc gatctatgat      1320
     ttcgccctca aggccgtcgg cctggatccc gacacggcaa gcacacggac catcaagcgc      1380
     gtcctgacca gcgacctcac ggatccgaaa agctacgtct actcgctcaa ggacgagcgt      1440
     tacgtgacgc tcgccaaact gttcaacttt acgacagagg gtgagatcgg cccgccggca      1500
     ctggctcaat cggaaacgca aatccaggaa acggcaaaga accatatcgt catcaagtcc      1560
     cgttttgggt cggaggacga caagaccaaa gctcaagagg aaagcgaata ttatacggcc      1620
     ggggttgcca agctctcctc gcttgacgaa ttccttgccg acgaccgcct tgtcaccata      1680
     gcgcttgagg cgaacggcat cgaccccgag ggggtgaccg ccgacgtgct ccgccagatc      1740
     ttcaactccg atctcgacga tcccgagagc gtcatcaacg aacaggaaaa ttccgctgcc      1800
     tatgtctcgc tcgttacttc cttcaatttc gatagcgaag gaaacgtgct gcgcgaggac      1860
     agggatagca tcgtcacgcg ccaggggctc tacgaaacgc tcgaccagta tctgcgccag      1920
     acgctggaag aacaggccgg cgagagcaat gaaggcgttc gcctcgcgct ctatttcgaa      1980
     cggaaggcgg ggtcgctcgt cgatgcctat gacctcctgg ccgacgacgc gcttgccgag      2040
     gtcttccgca cgatcttcag cctgcccgac gagttcagca cgatggacat cgaccagcag      2100
     gcgaagatcg tcgaaaagaa tctcgatctc gagaaactga gcgacccggc tgaactgaag      2160
     aagctgctgg cacgctttgc cgtgctttac gatctcgaaa acaacacgga ggtcgacccg      2220
     gctgtgtcgg tcctgacaag tacgggcagc agcgtcggca tcagcgccga cacgctctat      2280
     acgctgtccc agctccggat gggcgggtaa                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page