(data stored in ACNUC7421 zone)

EMBL: CP001389.PE476

CP001389.PE476       Location/Qualifiers
FT   CDS_pept        complement(537867..538466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24280"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF2"
FT                   /protein_id="ACP24280.1"
FT                   /translation="MAKLRYYDASGGTQAPTPKTAGHTEFLRTGRIDRRRPWLPEQRRY
FT                   MTHEEVAEKTGRKLQAAGETTHKRINGFHASIQFPKLIFHRTLADSPHLGYCHVTAART
FT                   NLNHSREIAWAFYFANFFSDLGDETHFFERIQPSYSRMYFAVAIEPNAEGGQMAINRNV
FT                   RGNGLIFRTQDPKVALKNVLMLGARDEALRRIIRRL"
     atggcaaagc tcagatatta cgacgcctcc ggcggaacac aggcgccgac gccgaaaacg        60
     gcgggccata cggaattcct gcgcaccggc cgcatcgacc ggcgccgccc gtggttgccc       120
     gagcagcgcc gctacatgac ccatgaggag gtggccgaga aaacgggccg gaagctgcag       180
     gcggccggcg aaacgaccca caagaggatc aacggctttc acgcctctat ccagtttccg       240
     aagttgatct tccaccggac gctcgccgac agtccccatc tcggctattg ccatgtgacg       300
     gccgcaagga ccaacctcaa tcactcgcgc gaaatcgcct gggctttcta tttcgccaac       360
     ttcttctcgg acctcggtga cgagacgcat ttcttcgagc ggatacagcc aagctattca       420
     cgcatgtatt tcgcggttgc gatcgagccg aacgccgaag gcgggcaaat ggccatcaat       480
     cgcaacgttc gcggcaatgg tctgatcttc cggacgcagg atccgaaagt ggcgctcaag       540
     aacgtcctga tgctcggcgc acgcgacgag gccctgcggc ggatcattcg ccgcctctaa       600
//

If you have problems or comments...

PBIL Back to PBIL home page