(data stored in ACNUC7421 zone)

EMBL: CP001389.PE477

CP001389.PE477       Location/Qualifiers
FT   CDS_pept        538526..538774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24281"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF3"
FT                   /protein_id="ACP24281.1"
FT                   /translation="MVNRLFRRFAGCLALLCVAKRPAVFAAETALLRKFSVWKRSTYRI
FT                   VYSIKYYRCLDVIARKSLSSFQNGMSHIGSCRAELPA"
     atggttaaca gactatttcg gcgcttcgcc ggttgtctcg ccttgctttg tgtcgcaaaa        60
     aggccagccg tcttcgcggc ggagacggcg cttctcagaa aattcagcgt ctggaagcgt       120
     tccacctatc gtattgttta ttctataaaa tattatagat gcctcgacgt gatcgcgcga       180
     aaatctctgt cgtctttcca aaatggaatg tcgcacatcg gcagttgtcg agccgaactc       240
     cccgcctag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page