(data stored in ACNUC7421 zone)

EMBL: CP001389.PE478

CP001389.PE478       Location/Qualifiers
FT   CDS_pept        538986..540236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04860"
FT                   /product="putative dioxygenase, alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24282"
FT                   /db_xref="GOA:C3MHF4"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF4"
FT                   /protein_id="ACP24282.1"
FT                   /translation="MGMDIQNDMLRKLKTRRDGYSLDRAFYIDPDYYRQDLEHIWYKDW
FT                   LFVGHDCEIPRPGNYFTLQVGDYPVVIVRDRQGAVRALHNSCRHRGSRVCTQHKGSSAK
FT                   LVCPYHQWTYELDGRLLFARQMPEGFDPSEHSLKPVNCETVGGYIFVSLADEPMDFQPF
FT                   RETVAGYLAPHRLGETKVAYESKIVEKGNWKLVWENNRECYHCAANHPELCRTYPEAPT
FT                   VTGVQGAMDDPEIGAHWERCEAAGLPSAFKIGPTGQFRMTRMPLINGAESYTMSGERAV
FT                   RQQLSAGVDANRIGTLLLFHYPTTWNHILGDHAITFRVLPLGPELTEVTTKWLVNKDAV
FT                   EGVDYTLEDLTHVWTETNDQDRQIVEENAFGIRSPAYQPGPYSAEHEGGVMQFVDWYSR
FT                   FMLDRLQGSAAPLSRVA"
     atgggcatgg acattcagaa cgatatgctg cgcaagctga agacgcgtcg cgacggctac        60
     agtctcgatc gggcttttta tatcgacccg gactactacc gccaggacct ggagcatatt       120
     tggtacaagg actggctctt cgtcggccac gactgcgaaa tcccgcggcc cggcaattat       180
     ttcacgctgc aggtcggcga ctacccggtc gtcatcgtgc gcgatcggca aggggcggtc       240
     cgggcgctgc ataactcctg tcgccaccgc ggctcgcgcg tttgtacgca gcacaagggc       300
     tcctcggcca agctcgtctg tccctatcac cagtggacct acgaactcga cggccggctg       360
     ctttttgccc ggcagatgcc ggaaggcttt gatccgtccg agcacagcct gaagccggtc       420
     aattgcgaga ccgtcggcgg ctacatcttc gtcagcctcg ccgacgagcc gatggatttc       480
     cagccgttcc gagagaccgt tgccggctat ctggcgccgc atcgcctagg cgaaaccaag       540
     gtcgcctacg agagcaagat cgtcgagaag ggcaactgga agcttgtctg ggagaacaac       600
     cgcgagtgct accattgcgc cgccaaccat ccggaactct gccggaccta tccggaggct       660
     ccgaccgtga ccggcgtcca gggcgccatg gacgatccgg aaatcggtgc ccattgggaa       720
     agatgtgagg cggcggggct gccgagcgcc ttcaagatcg gcccgaccgg ccagttccgc       780
     atgacgagaa tgccgctcat caacggggcc gagagctata cgatgtccgg cgagagggcc       840
     gtgcgccaac agctttccgc cggcgtcgac gcgaaccgca tcggcacgct gcttctcttc       900
     cattatccga cgacctggaa ccacatcctc ggcgaccacg cgatcacctt ccgggtcttg       960
     ccgctcgggc cggaactgac tgaggtcacg accaaatggc ttgtcaacaa ggatgcggtc      1020
     gagggtgtcg actatacgct cgaggatctg acgcatgtct ggaccgagac caacgaccag      1080
     gaccgccaga tcgtcgagga aaacgcattc ggcatccgtt cgccggccta tcagccgggg      1140
     ccctattcgg cggaacacga ggggggcgtc atgcagttcg tcgactggta ttcgcgcttc      1200
     atgctggatc gcctgcaggg cagcgccgct cctctgtcgc gggtggcatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page