(data stored in ACNUC7421 zone)

EMBL: CP001389.PE479

CP001389.PE479       Location/Qualifiers
FT   CDS_pept        539981..541333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04870"
FT                   /product="putative dioxygenase reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24283"
FT                   /db_xref="GOA:C3MHF5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF5"
FT                   /protein_id="ACP24283.1"
FT                   /translation="MACQQGCGRGCRLYARGSDACLDRDQRPGPPDRRGKRIRHPFAGL
FT                   SAGALFGGTRGGRHAVRRLVFALHAGSPAGQRRSSVAGGMTMEMARSFHHFDELHPWID
FT                   RQHLLECTSVVAETADVMTFTFRSDRPAWFRYLPGQFVTLELPTGEEPVMRTYTLSSTP
FT                   SRPLSVAVTVKAQSNSIGTRWMFDNLKPGMVLKALGPLGDFSFVRHPGEKYLFISAGSG
FT                   ITPMMSMTRWMADCAPATDVTFVSCARQPEDLLFKSELEILARQMPHLNLGFLVEGHEA
FT                   RHGWHGLRGRIDATKLPLLAPDVLERTVFCCGPEPFMRGVRDMLKGAGFDMARYHQESF
FT                   QPAAAPAAEELAIRAGPATGAGAEAARVTFTMSGKDVSAVPGQTILQTARANGVRIGAA
FT                   CEGGICGTCRVLKIAGDVAMNHNGGILDDEIDEGYILACCSRPLGDVQIEA"
     atggcttgtc aacaaggatg cggtcgaggg tgtcgactat acgctcgagg atctgacgca        60
     tgtctggacc gagaccaacg accaggaccg ccagatcgtc gaggaaaacg cattcggcat       120
     ccgttcgccg gcctatcagc cggggcccta ttcggcggaa cacgaggggg gcgtcatgca       180
     gttcgtcgac tggtattcgc gcttcatgct ggatcgcctg cagggcagcg ccgctcctct       240
     gtcgcgggtg gcatgaccat ggaaatggcc cgctccttcc accatttcga cgagctgcac       300
     ccctggatcg atcgccagca cctgcttgaa tgcacctccg tggtcgccga gaccgcggat       360
     gtgatgacct tcaccttccg ctccgacagg ccggcctggt tccgctatct gcccgggcag       420
     ttcgtgacgc tcgaacttcc gaccggcgag gaaccggtca tgcgcaccta cacgctgtcg       480
     tcgacgccgt cgcgcccgct ttcggttgcc gtgacggtga aggcgcagtc gaacagcatc       540
     ggcacgcgct ggatgtttga caatctgaag cccggcatgg tgttgaaggc gctggggccg       600
     ctcggcgatt tcagcttcgt ccggcatccg ggcgaaaaat atctcttcat ctcggccggg       660
     tccggcatca ccccgatgat gtcgatgacc cgctggatgg cggactgcgc gccggcaacg       720
     gatgtcacct tcgtctcctg cgcgaggcag ccggaagacc tgctattcaa gtcggagctc       780
     gagatcctcg cccgccagat gccgcacctc aatctcggct tcctggtgga agggcacgaa       840
     gcccgtcacg gttggcacgg cctgcgcggc cgcatcgatg cgacgaagct gccgctgctc       900
     gcaccggatg ttctcgagcg aacggtcttc tgttgcggcc ccgagccctt catgcgcggc       960
     gtccgggaca tgttgaaagg ggccggcttc gacatggccc gctaccacca ggaaagcttc      1020
     cagccggcag cggccccggc ggcagaggag cttgccattc gcgccggacc ggcgaccggc      1080
     gctggcgccg aggcggcgcg ggtgaccttc acgatgagcg gcaaggatgt ttcggcggtc      1140
     cccggccaga cgatcctgca gacggcacgc gccaacggcg tcaggattgg tgccgcctgc      1200
     gagggcggca tctgcggcac gtgccgcgtg ttgaagatcg ccggcgatgt cgcgatgaac      1260
     cacaatggcg gcattctcga cgacgagatc gacgagggct acatcctcgc ctgttgctcg      1320
     cggcccttgg gcgacgttca gatcgaggcg tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page