(data stored in ACNUC7421 zone)

EMBL: CP001389.PE480

CP001389.PE480       Location/Qualifiers
FT   CDS_pept        complement(541373..542398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04880"
FT                   /product="glycoside hydrolase family 25 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24284"
FT                   /db_xref="GOA:C3MHF6"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF6"
FT                   /protein_id="ACP24284.1"
FT                   /translation="MRLAALVGLTFAAANARAADVEPWKARQNAIIVDAYELNSIDWDA
FT                   MLKDKRIAGFIAKASDGLPESFTCTGDHGGDTVAHCKTMWRKYAVSRELYQTRRMIARF
FT                   QGLLWGAYHLARPGNPVDQANHFLDYAEPRDDELMVLDIEGIDPEDYMSLEDAAIFAGH
FT                   IKARTGRYPILYTNHITAKYIAANRHQHRLLSRLPLWYARYKPDIRDVFPMGNWDGYAL
FT                   WQFSSSHNCGKKRCPYRVPGTLNDIDVNVAAMSVSELKKVWAQGALLPEKPPIVTVVAS
FT                   AKLGSAPAASAAVSIPLTQPLLISRAEADSGSGTGVDGTVTGAISVKAAEVHLPNQPER
FT                   R"
     ttgcgcctgg cggccctggt gggcctgacc tttgcggcgg cgaacgcacg cgccgctgac        60
     gtcgagccgt ggaaagcgcg gcagaacgcc atcatcgtcg acgcatacga gttgaacagc       120
     atcgactggg acgcgatgct gaaggacaag cgcatcgccg ggttcatcgc gaaagcctcc       180
     gacggccttc ctgaaagctt tacctgcacc ggcgatcacg gcggagacac tgtcgcccac       240
     tgcaagacga tgtggcgaaa atatgcggtc agccgggaac tctaccagac ccgccggatg       300
     atcgcgcgct tccagggact gctgtggggc gcctatcatt tggcgcggcc gggcaatcct       360
     gtcgatcagg ccaatcactt cctcgactat gcggagccgc gcgacgacga actgatggtc       420
     ctcgacatcg agggcatcga tccagaagac tacatgtcgc tcgaggacgc cgcgatcttt       480
     gccggccaca tcaaggcccg caccgggcgt taccccatcc tctataccaa ccacattacc       540
     gcgaaataca tcgccgccaa ccgccatcaa caccggctgc tttcgcgcct gccgctctgg       600
     tatgcccgct acaaacccga cattcgcgac gtcttcccga tgggcaactg ggacggctac       660
     gcgctatggc aattctcgtc gtcccataat tgcggaaaga agcgctgtcc ctatcgcgtc       720
     ccgggcacgc tcaacgacat cgacgtcaat gtcgccgcga tgagcgtttc ggaattgaag       780
     aaggtctggg cgcaaggcgc gctcctcccg gaaaagccgc cgatcgtcac ggtcgtcgct       840
     tccgcgaagc tcggcagcgc gcctgcagcg agcgcagccg tctccatccc gctcacgcag       900
     cccctgctca tcagccgcgc cgaggccgac agcggatcgg gcaccggcgt cgacggaacg       960
     gtcaccgggg cgatcagcgt aaaagcggcc gaggtgcatc tgcccaacca gcccgagcgc      1020
     cgctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page