(data stored in ACNUC7421 zone)

EMBL: CP001389.PE481

CP001389.PE481       Location/Qualifiers
FT   CDS_pept        complement(542597..543586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04890"
FT                   /product="putative cationic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24285"
FT                   /db_xref="GOA:C3MHF7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF7"
FT                   /protein_id="ACP24285.1"
FT                   /translation="MNLISPEIPGLVWAYRFLPGESRCVPLATDSPVDSLQTGDGWIWL
FT                   HLALSDARTPALIERIGNLPPAAIATLTSHDTQAAITVAEDVVYGTLVDFERTFDTMTK
FT                   TIGWLHFAVSDRMIITTRLHPLRSIDRVKAAVEKSAKCGRPIDLFEMLVVEFQRTLITL
FT                   VLELTEELNVIEDRVYGEAGHRQQPGLAPLRRTVVRLHRHLRTILALLRRAGASDEDEV
FT                   PPGFIDAAERLSDRLETVDRDVFALQERARLLHEEIDSKISSETNRHLYILSLMTAFLL
FT                   PPTLVTGFFGMNTGALPFADGSGTFFAGLIIAASMGLAWLILKRVGIL"
     atgaacctga tttctcccga gatacccggc ctcgtctggg cctaccggtt cctgcccgga        60
     gaaagccgtt gcgtgcccct cgcgaccgat tcgcccgtcg acagcctgca aaccggcgac       120
     ggttggatct ggctgcatct ggcgctgagc gatgcgcgca cgccggcgct gatcgagcgc       180
     atcggcaatc tgccgccggc ggcgattgca acccttacca gtcacgacac ccaggcggcg       240
     attaccgttg ccgaggacgt cgtctacggc acgcttgtcg atttcgagcg aaccttcgac       300
     acgatgacca agacgatcgg ctggctgcat ttcgccgtca gcgaccggat gatcatcacc       360
     acccgcctgc atccgctgag aagcatcgac cgcgtcaagg cggccgtcga gaaaagcgcc       420
     aaatgcggcc ggccgatcga tctcttcgag atgctggttg tcgagttcca gcggacgctc       480
     atcaccctgg tgctcgaatt gacggaggag ctgaacgtca tcgaggaccg ggtctatggc       540
     gaagcggggc accggcagca gccggggctc gcgcccttgc gccgaacggt ggtgcgcttg       600
     catcggcatc tgaggacgat cctcgccttg ctgcggcgcg ccggcgcctc ggatgaagat       660
     gaggtgccgc cgggcttcat cgacgcggcc gagcggcttt cggaccggct ggagacggtc       720
     gaccgcgacg tctttgcact tcaggagcgc gccaggctgc tgcacgagga gatcgacagc       780
     aagatttcct cggagaccaa ccgccacctc tacatcctgt cgctgatgac cgccttcctc       840
     ctgccgccga cgctcgtcac cggtttcttc gggatgaata cgggcgccct gcccttcgcc       900
     gacggcagcg gcacattctt tgccgggctg atcatcgccg cttccatggg actggcatgg       960
     ctcatcctca agcgcgtcgg catcctgtag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page