(data stored in ACNUC7421 zone)

EMBL: CP001389.PE482

CP001389.PE482       Location/Qualifiers
FT   CDS_pept        543873..545654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04900"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24286"
FT                   /db_xref="GOA:C3MHF8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF8"
FT                   /protein_id="ACP24286.1"
FT                   /translation="MYKAPVDEIAFTLKHVAGMAEAVRAGTFGELGEDLVEAILSEAGR
FT                   FATEEVAPLGEVGDRQGSRLVDGAVKTPEGWRDLYHDWIQGGWNGLTAPEAFGGQDLPH
FT                   MLHVAAMEMWNSGSMAFALGPTLTMGAIEAVEKHGSDALKATFLSKMVSGEWMGTMNLT
FT                   EPHAGSDLGVLKTRAERRADGTYRIFGQKIFITWGEHDFTDNIVHLVLARLPDAPAGTK
FT                   GISLFLVPKFLVNADGSLGARNDLFCHSLEHKLGIHGSPTCTMIYGDGRFGDEKGAIGY
FT                   LVGEENRGLACMFTMMNNARLAVGMQGVAIAEAATQKAIAYARERTQGRAPGWTGQGMS
FT                   PIIEHPDIARTLLTMKALTQGARAIAYACAHAVDMAHASHSEKAHQWQERSSLLTPIAK
FT                   SFATDAGVDVASMGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLR
FT                   LSEGAQVRGFIGELREVAHAVAASNRQGFGETAARLEASIADLADATEWLLAALAEGRT
FT                   AEALAGATAYQRLFGLALTGVYLAKGGLAEAGDGKQEARIALCRFAAENLLAETAALRD
FT                   RVVAGADSLAAARAILD"
     atgtacaagg caccggtgga cgagatcgca ttcaccctga agcacgtggc cggcatggcc        60
     gaggccgtgc gagcgggcac tttcggtgaa cttggcgaag acctcgtcga ggcgatcctg       120
     tcggaagccg gccgctttgc aaccgaagag gtggcgccgc tcggcgaggt cggcgaccgg       180
     cagggctcac ggcttgtcga cggcgcggtc aagacgccgg agggctggcg cgatctctac       240
     catgactgga ttcaaggtgg ctggaacggc ctgacggcgc ccgaggcttt tggtggccag       300
     gacctgccgc acatgctgca tgtcgcagcc atggagatgt ggaacagcgg ctccatggcc       360
     ttcgcgcttg gcccgacgct gaccatgggt gcgatcgaag cggtcgagaa gcatggctcg       420
     gatgccttga aggcgacctt tctgtcgaag atggtctccg gcgagtggat ggggacgatg       480
     aacctgaccg agccgcatgc cggttcggat ctgggcgtgc tcaagacccg tgccgagcgc       540
     cgcgccgacg gcacctaccg catcttcggc cagaagatct tcatcacctg gggcgagcac       600
     gatttcaccg acaacatcgt ccacctcgtc ctggcgcgct tgccggatgc gccggccggc       660
     acgaagggca tctcgctctt tctcgtgccg aaattcctcg tcaatgcgga cggttcgctc       720
     ggcgcccgca acgatctttt ctgccattcg ctcgagcaca agctcggcat tcacgggtcg       780
     ccgacctgca cgatgatcta cggcgacggc aggttcggcg atgaaaaggg tgcgatcggt       840
     tacctggtcg gcgaggaaaa ccgcgggctt gcctgcatgt tcacgatgat gaacaacgcc       900
     cgcctggccg tcggcatgca gggcgtggcg atcgccgagg ccgccaccca gaaggcaatc       960
     gcctatgcca gggaacgcac ccagggccgg gcgcccggct ggaccggtca aggcatgagc      1020
     ccgatcatcg agcatccgga tatcgcccgc acgttgctga cgatgaaggc gctgactcaa      1080
     ggggcgcgcg ccattgccta tgcctgcgcg cacgccgtcg acatggcgca tgcgagccac      1140
     agcgaaaagg cccaccaatg gcaggagcgc tcgagcctgc tgacgccgat tgccaaatcc      1200
     tttgccacag atgccggcgt cgacgtcgcc tccatgggca tccaggtgca tggcggcatg      1260
     ggtttcatcg aggaaaccgg tgcggcccgc tatctgcgcg acgcgcgcat tgcgccaatc      1320
     tatgaaggca ccaacggcat ccaggcgatc gacctcgtca cccgcaagct gcggctctcg      1380
     gagggcgccc aggtgcgcgg cttcatcggc gagcttcgtg aagtcgctca tgccgttgcg      1440
     gcttcgaaca ggcaggggtt cggggagacc gcagcgcgcc tggaggcgtc gattgccgat      1500
     cttgccgacg ccaccgaatg gctgcttgca gcactggccg agggacgaac cgccgaagcg      1560
     cttgccggcg cgaccgccta ccagcgcctc ttcggcctgg cgctgaccgg cgtctatctc      1620
     gccaagggcg gcctggcgga agccggtgac gggaagcagg aggcgcgcat cgcgctctgc      1680
     cgcttcgccg cggaaaatct gctggccgaa acggcggcgc tcagggaccg cgtcgtcgcc      1740
     ggggcggaca gcctcgccgc cgcccgcgcc attctcgact aa                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page