(data stored in ACNUC7421 zone)

EMBL: CP001389.PE484

CP001389.PE484       Location/Qualifiers
FT   CDS_pept        546793..548892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04920"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24288"
FT                   /db_xref="GOA:C3MHG0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG0"
FT                   /protein_id="ACP24288.1"
FT                   /translation="MSKRSNLMTRILVAASCVVVGAFAGFSVYIDTLQRGTTTKAVEEN
FT                   IASSGKQAAESVANWLNGRVTLTAMAADAAARASDEAAILAALKNDVLTGEFMSTYVGN
FT                   GSGKFITWPEMKLPEGYDPRQRPWYQQAVKTDARVLTEPYIDASSGDLIISAAMPVKRE
FT                   GKLYGVAASDFSLKTLVSMITDIDVGGEGFAFLASKDGQILVHPDAKLVTKTLSDAFPV
FT                   DTPSIGSGIMHTELGGKPMLVSFVPVQGLPSVEWYIGFALDADAAYSAISQFRIAATVA
FT                   TLLAVGAMIVFLATLLSRLVIRPVTQMTGAMEKLAAGNLDVAIPGEERRDQIGSMAAAV
FT                   AVFRANALERARLEDEAHANRSLSERERLEREAQKARDVAEVQHAVEALATGLGRLADG
FT                   DLAYRIENPFADRLDRLRADFNNSVAKLHDALRAVGANARAIDAGASEIRSAADDLARR
FT                   TEQQAASVEETAAALEEITTTVKDSAHRAEEVGGLVARTRAGAEKSGEVVQNAVEAMQA
FT                   IEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAN
FT                   AAKEIKALITTSGDQVRSGVALVGETGRALQAIVAEVQEINKHVSAIVTATREQSTGLQ
FT                   EINTAVNTMDQGTQQNAAMVEEQTAASHGLAQEAAALNALLAQFKLGDGQASASFVAGQ
FT                   RRYAA"
     ttgtccaaac gatcgaatct gatgacgcgc atcctggttg ccgcgtcctg cgtcgtcgtc        60
     ggcgccttcg ccggcttttc cgtctacatc gatacgcttc agcgcggcac gaccacaaag       120
     gccgtcgaag agaatattgc ctcctccggc aagcaggcgg ctgaaagcgt cgccaactgg       180
     ctgaacggcc gcgtgacgct caccgccatg gcggcggacg ctgcggcgcg cgcaagcgac       240
     gaggccgcca tccttgccgc actcaagaac gatgtcctga ccggcgagtt catgtcgacc       300
     tatgtcggca acgggagcgg caaattcatc acctggccgg agatgaagct gcccgagggc       360
     tatgacccgc gccagcgtcc ctggtatcag caggcggtca agaccgacgc ccgcgtgctc       420
     accgagccct atatcgacgc ctcgagcggt gacctgatca tcagcgcggc catgccggtc       480
     aagcgagaag gcaagctcta tggcgtcgct gccagcgact tctcgctgaa aaccctggtc       540
     tcgatgatca ccgacatcga cgtcgggggt gaggggtttg ccttcctggc aagcaaggac       600
     ggccagatcc tcgtccatcc cgatgccaag ctcgtgacga agacgctttc cgatgccttc       660
     ccggtcgata caccttcgat cggcagcggc atcatgcaca ctgaactcgg cggcaagccg       720
     atgctcgtca gtttcgtgcc ggtccagggg cttccctccg tggaatggta tatcggcttc       780
     gcgcttgacg ccgacgccgc ctattcggcg atcagccagt tccgcatcgc cgcgaccgtt       840
     gcgacccttc ttgccgtcgg cgccatgatc gtcttcctgg caactctgct cagccgtctc       900
     gtgatccgcc cggtaacgca gatgaccggc gccatggaga agcttgccgc cggcaatctt       960
     gacgttgcca tcccgggcga ggaacgtcgt gaccagatcg gctccatggc ggcggccgtc      1020
     gccgtcttcc gtgccaatgc cctcgaacgc gcccggctcg aggacgaggc gcatgccaac      1080
     cggtcgctct ccgagcgcga gcgcctcgag cgagaggcgc aaaaggcgcg tgatgttgcg      1140
     gaagtccagc atgccgtaga agcgctggcg accggcctcg gccggcttgc cgacggtgat      1200
     ctcgcctacc ggatcgaaaa tcctttcgcc gatcgcctcg accggctgag agccgatttc      1260
     aacaattccg tcgccaagct gcacgatgcg ctccgcgccg ttggcgccaa tgcccgggcg      1320
     atcgatgccg gtgcgagcga gattcgttcg gctgccgacg atcttgcccg ccgcaccgaa      1380
     cagcaggcgg cctccgtcga agagaccgct gcagcgctcg aagagatcac cacgaccgtg      1440
     aaggactccg cccatcgcgc cgaggaggtt ggcggtctcg tcgcccgcac ccgcgccggc      1500
     gcggagaaat ccggcgaagt ggtgcagaat gcggtcgagg cgatgcaggc gatcgagaag      1560
     tcatcgggtg agatctccaa cattatcggc gtgatcgacg acatcgcctt ccagaccaat      1620
     ctgctggcgc tcaatgccgg cgtcgaggcg gcgcgggcag gcgaggccgg taagggtttt      1680
     gccgtcgtcg cccaggaagt gcgcgaactc gcccagcgtt cggccaatgc cgccaaggag      1740
     atcaaggcgc tgatcaccac ctccggcgac caggtccgct ccggcgtggc gctggtcggc      1800
     gaaaccggcc gggcgctgca ggcgatcgtc gccgaagtgc aggagatcaa caagcatgtc      1860
     agcgcgattg tcaccgcgac gcgcgaacag tcgaccggtc ttcaggagat caacacggcg      1920
     gtgaacacga tggaccaggg cacgcagcag aatgcggcga tggtcgagga gcagacggct      1980
     gcgagccacg ggctggcgca ggaagccgcc gcgctcaatg cgctgctcgc tcagttcaag      2040
     ctgggggatg ggcaggcgtc tgcaagcttc gtcgccggcc aacgccgcta cgcggcctga      2100
//

If you have problems or comments...

PBIL Back to PBIL home page