(data stored in ACNUC7421 zone)

EMBL: CP001389.PE486

CP001389.PE486       Location/Qualifiers
FT   CDS_pept        complement(550182..550937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04940"
FT                   /product="hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24290"
FT                   /db_xref="GOA:C3MHG2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG2"
FT                   /protein_id="ACP24290.1"
FT                   /translation="MSDNKHSTIRLDQLLLNKGLVASRARARDAIQRGTVMVDGRTVTK
FT                   PATAFAANATITIDDPAQDYVSRAALKLVGALDHFGFDPAGQICLDIGASTGGFTEVLL
FT                   KRGAAHVVAVDVGHGQMHPRIAEDPGVTNIEGLNARAMTADDIGNRTITFIVSDVSFIS
FT                   LKLALPPALSLAGPGARCILLVKPQFEAGRDAISKAGLLKDPESAPTVAAELERWLVED
FT                   MGWRSLGLVPSPIAGGDGNKEFLLAGLKP"
     atgtccgata acaagcactc cacgatccgg ctcgaccaat tgctgctgaa caagggcctg        60
     gtggccagcc gcgcccgcgc ccgcgacgcg atccaacggg ggaccgtcat ggtcgacggg       120
     cgcaccgtga ccaagcccgc cactgccttt gcggcaaacg caacgatcac gatcgacgat       180
     ccggcgcagg attatgtctc ccgcgccgcc ttgaagctcg ttggcgcact cgaccatttc       240
     ggcttcgatc cggcaggtca gatctgcctc gacatcggcg cctcgacggg gggcttcacc       300
     gaggtactcc tgaaacgcgg tgccgcccat gtcgtcgcgg tcgacgtcgg ccacgggcag       360
     atgcatccgc gcatcgcgga agacccgggg gtcacgaata tcgaagggct gaatgcccgg       420
     gcgatgacgg cagacgatat cggcaaccga accatcacct tcatcgtctc cgacgtgtcc       480
     ttcatctcgc tcaagctggc gctgccgccg gcgctgtccc ttgccgggcc cggcgcccgt       540
     tgcatcctgc tcgtcaagcc gcagttcgag gccggacgcg atgcgatcag caaggccggc       600
     ctcctcaagg atccggagag tgcgcccacc gtcgccgccg agctcgagcg ctggctggta       660
     gaagacatgg gctggcggag ccttggcctc gtcccctcgc ccattgccgg cggcgacggc       720
     aacaaggaat ttctcctcgc agggctgaag ccatga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page