(data stored in ACNUC7421 zone)

EMBL: CP001389.PE488

CP001389.PE488       Location/Qualifiers
FT   CDS_pept        complement(553261..554184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04960"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24292"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG4"
FT                   /protein_id="ACP24292.1"
FT                   /translation="MSFFPGPDPLAGDKPACDAIEHLIIPRTSDIGNLEVRRALPTARR
FT                   RLVGPFIFFDRMGPALLRAGQAIDVRPHPHIGLSTVTYLFDGEIKHRDSLGTEMVIRPG
FT                   DVNLMTAGRGIVHSERSPESQRGHERSLSGLQTWLALPDDKEEVDPVFSHTEERVLPHL
FT                   ADDGVRARVVIGRFEGAASPVSTFTDTIYVDLAIEAGRSAPFAAQWEERAIYILSGEAI
FT                   IAGDHFADNQLLVFRPGDEITITAGPAGCHVMLFGGAALGSPRHIWWNFVSSSKERIDK
FT                   AKEEWRSGRFDIVPGDEEEFIPLPAS"
     atgtcgtttt ttcccggtcc cgatccgctc gccggcgaca agccggcctg tgacgccatc        60
     gagcacctga tcatcccgcg caccagcgac atcggcaacc ttgaggtgcg ccgggcgctt       120
     ccgacggcac gacgccggct cgtcggtccg ttcatcttct tcgaccgcat gggaccggcg       180
     ctgctgcgcg ccggccaggc gatcgacgtg cgaccgcatc cgcatatcgg cctgtcgacg       240
     gtcacctacc tcttcgacgg cgagatcaag catcgcgaca gcctcggcac cgaaatggtg       300
     atccgccccg gcgacgtgaa cctgatgacg gcggggcgcg gcatcgtgca ttccgagcgc       360
     tcgccggaaa gccagcgcgg ccatgaacgg tcattgtcgg gattgcaaac ctggctggcg       420
     ctccccgacg acaaggaaga ggtcgatccg gtcttctccc ataccgaaga gcgcgtgctg       480
     ccgcatcttg ccgatgacgg cgttcgcgca agggtcgtca tcggccggtt cgaaggcgct       540
     gcctcgccgg tctccacctt caccgacacg atttatgtgg atctcgcgat cgaggccggc       600
     cgcagcgctc cctttgccgc ccaatgggag gaacgcgcca tctatattct ttcgggcgaa       660
     gcgatcattg cgggcgatca tttcgccgac aaccagcttc tcgtcttccg gcccggcgac       720
     gagatcacca tcaccgcggg gccggccggc tgtcatgtca tgctgttcgg cggcgcggcg       780
     ctcggctcgc cgcggcatat ctggtggaac ttcgtttcct cgtccaagga gcgtatcgac       840
     aaggcaaagg aagaatggcg cagcggccgc ttcgatatcg tgccggggga cgaggaagag       900
     ttcatcccct tgccggcaag ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page