(data stored in ACNUC7421 zone)

EMBL: CP001389.PE489

CP001389.PE489       Location/Qualifiers
FT   CDS_pept        complement(554367..555746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04970"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-13j"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24293"
FT                   /db_xref="GOA:C3MHG5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG5"
FT                   /protein_id="ACP24293.1"
FT                   /translation="MPRRIGRDRCPVGSPRRSCIRFRAPVQGSAKIAVARRLGRGEGMT
FT                   DQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAELAAWLTATSGATEAGQI
FT                   QVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAKDDSRDAEVMASALRTD
FT                   RRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLWRYFPALLELENDLGAE
FT                   WLLDLWEAVPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAVLRTPPVKVAAGTTEAA
FT                   SAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEATEPGQRKQHDVEILASLPGVGR
FT                   IVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIRRQACHDRLANAMYHWA
FT                   RVAIQHDSRSRLKYAALRSQGHSHGRALRSVADRFVNVACAMLKTGTTFNPSLAEQKLS
FT                   C"
     gtgccccgtc ggattggccg tgatcgatgc cccgtgggga gtccgcgccg gagctgtatc        60
     cgtttccgag cgccagtaca gggatcggcg aagatcgcgg tggctcgcag gcttggacga       120
     ggagaaggga tgaccgatca gaaacaattc tatgccggcg tcgactgggc gtcggagagc       180
     catcatgtgt tcctcacgga tggtgatggc cggaaaatcg gcgaaagggt cttcaggcac       240
     ggcggcgaag ggctcgccga gctggcggcc tggctgacgg caaccagcgg tgcaaccgag       300
     gccgggcaaa tccaggtcgc gatcgaggtg ccgcacgggc ccgtggtcga gacgctgatc       360
     gagcgcggct gccaggtgca tgccatcaac ccgaaacaaa tggatcgctt tcgcgaccgg       420
     ttcaccctgg ccggcgccaa ggacgacagc cgcgatgccg aagtgatggc ctcggccttg       480
     cgcaccgatc gccggtgctt ccggctgctt gccgccgccg atcctgtcgt catcgaattg       540
     cgcgaatggt cgcgcatggc cgaggacctc ggcgccgagc gcaaccggtt gaccaaccgc       600
     atgcgcgagc agctctggcg ctactttcct gcgctgctcg agctcgaaaa cgacctcggg       660
     gccgagtggc tgctcgatct ctgggaagcc gtgccgacgc cggccaaagc cgcgcggatc       720
     cgcgcggcga cgatcgccaa gcttctcaaa cgcaaccgca tccgccgcgt cgacgccacc       780
     catgtgctcg ccgtgctgcg cacgccgccc gtcaaggtcg ccgccgggac gaccgaagcc       840
     gccagcgccc acattgccac gctcattgcc cgcattcgcc tcgtgaaccg gcagctcaag       900
     caagcgcatc agcggctcga taccctgact gcccgccttg tcccgaccga ggcgaccgag       960
     ccggggcaga ggaagcagca tgacgtggag atcctcgcat ccttgccggg agtgggaagg      1020
     atcgtcctcg ccacgctgct cgcagaagcc ttcgatgccc tgcagcgacg tgaccacgcc      1080
     gccttgcgca gtttgacagg agtcgcgccc gttaccaagc ggtccggcaa gagctgcatc      1140
     gtcatcagaa gacaggcctg ccacgaccgg ctcgccaacg ccatgtacca ttgggcacgc      1200
     gtcgccattc agcacgactc tcggagccgt ttgaagtacg ccgcccttcg aagtcaaggt      1260
     cacagccacg gtcgtgccct gcgatccgtc gccgaccgct tcgtcaacgt cgcatgcgca      1320
     atgctgaaaa ccggcaccac cttcaatcct tccttggccg agcagaaact ctcttgctaa      1380
//

If you have problems or comments...

PBIL Back to PBIL home page