(data stored in ACNUC7421 zone)

EMBL: CP001389.PE493

CP001389.PE493       Location/Qualifiers
FT   CDS_pept        558259..558660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24297"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG9"
FT                   /protein_id="ACP24297.1"
FT                   /translation="MDGTERENVTEIRIPFRDIDMHGHMHNAAYYAHAEAALASLWRHR
FT                   PPVNNEPAYLVRRSACLFHRGLRFDEPARFTVSVAKIGGSSVSFAVRVEAGAHLAAEVE
FT                   IVWVAVDPARHQPVALPAATRDWLSAYIA"
     atggacggca cagagcggga aaatgtcacg gaaatccgta ttccgtttcg cgatatagac        60
     atgcatggcc acatgcacaa tgcggcctat tacgcgcatg ccgaggcggc gctcgccagt       120
     ctctggcggc atcggccgcc cgtcaataac gaaccggcct atctggtgcg tcgctcggcc       180
     tgcctcttcc atcgcggctt gcgtttcgac gagccggccc gcttcaccgt atctgtcgcc       240
     aagatcggcg gcagttcggt gagtttcgcg gtgcgggtcg aagccggcgc gcatctcgcg       300
     gcggaggtcg agatcgtctg ggtcgccgtc gatcccgctc gccatcagcc cgtggcatta       360
     cccgctgcaa cccgcgactg gctttctgcc tatatagcct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page