(data stored in ACNUC7421 zone)

EMBL: CP001389.PE495

CP001389.PE495       Location/Qualifiers
FT   CDS_pept        complement(559825..561321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05030"
FT                   /product="putative long-chain-fatty-acid--CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24299"
FT                   /db_xref="GOA:C3MHH1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH1"
FT                   /protein_id="ACP24299.1"
FT                   /translation="MPLARAILRHEGERLHAPAFRIEGRVFTFAELAAAAGRILHAIEQ
FT                   AALQTTEQSVLAGRVRLIALETGNHPLFAAAFIAATSGGNCAALIDPHLPESRRQRMKE
FT                   KLRPEIVIRADGDRLHLDVPSVGETHALETFDGSSPISIGEDAEPFLVVFTSGTTGEPK
FT                   AIIRDRGSWRLSLETGQHFFGIGPEATTYAPGPLAHGLALYALVECLAAGAEFIGARHF
FT                   EPRQALDVISDTRAKRLVLVPTMLRRLCEQTKSAAVTSVEKITVAGAKLTPADRSAAAR
FT                   AFPAAEVIEYYGASELGFITVAGADDDHSPTAVGKPFPGVRLAILDDRGNSLPSGETGA
FT                   IFVDSALISYGYIASNDGIGFHREGRLATVGDLGFLDRDGTLHLIGRAGGMVLSGGNNI
FT                   YPSEVEAAIMAAAGVRSVLVFGIDHPDLGSELVAVIQPNHDRFEREELERHLADALPRY
FT                   KHPRKVWLCREMPMTVSGKIAVGKLQQWIAEENGALERLF"
     atgccgctcg cacgggccat tctgcggcat gagggcgaac gcctgcacgc cccggccttc        60
     cgcatcgagg gccgggtttt cacattcgcc gagcttgccg cggccgcagg tcgcattctg       120
     cacgcgatcg aacaggcggc cctgcagaca acggaacaaa gtgtccttgc cggccgggtg       180
     cggctgattg cgctcgaaac cggcaatcac ccgctctttg ccgcggcctt catcgcagcg       240
     acgtcgggcg gcaattgtgc ggcactcatc gatccgcacc tgccggaatc gcgccgccag       300
     cggatgaagg aaaaactgcg gccggagatc gtcatccgtg ccgacggcga tcgcctgcac       360
     ctggacgtcc cctccgtagg agagacgcat gcgctcgaga ctttcgacgg ttcgtctccg       420
     atcagcatcg gcgaggatgc cgaacccttc ctcgtggtct tcacctccgg cacgaccggc       480
     gagccgaagg cgatcatccg cgaccgcgga tcctggcgcc taagccttga aaccggtcag       540
     cacttcttcg gcataggacc ggaagcgacg acctatgcac ccggtccact ggcgcacggg       600
     ctggcgcttt atgcccttgt cgagtgcctt gcggccggag ccgaattcat cggcgcccgt       660
     catttcgaac cgcgccaggc gctcgatgtc atcagcgaca ccagggcgaa gcgcctggtg       720
     ctggtgccga cgatgctgcg tcggctttgc gaacagacga agtccgcggc cgtgacctct       780
     gttgaaaaga tcaccgttgc cggcgccaaa ctgacaccgg cggaccgcag cgccgcggct       840
     cgggctttcc ccgccgcgga agtgatcgaa tactacggcg catcggaact cggcttcatc       900
     accgttgccg gcgcagatga cgatcattcc ccgactgccg tcggaaagcc attcccgggc       960
     gtccggctgg ccatcctcga cgatcgcggc aacagcctgc cgtcgggaga aaccggggcg      1020
     atcttcgtcg acagcgcgct gatatcgtac ggctacatcg ccagcaacga cggcatcggt      1080
     tttcaccgcg aagggcggct cgccaccgtc ggcgacctcg gatttctcga cagggacggc      1140
     acgctgcatc tcatcggccg tgccggcggc atggtgctct ccggcggcaa caatatctat      1200
     ccctccgaag tcgaggccgc gatcatggcc gcggccgggg ttcggtcggt gttggtcttc      1260
     gggattgatc atccggatct cggcagcgag cttgtcgcgg tcatccagcc aaaccatgat      1320
     aggttcgagc gcgaggagct ggagcgtcat cttgctgacg ctctgccgcg ctacaagcat      1380
     ccgcgtaagg tctggctctg ccgggagatg ccaatgaccg tctccggcaa gatcgccgtc      1440
     ggaaaactgc agcaatggat cgcggaggag aacggtgccc ttgaacgcct cttctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page