(data stored in ACNUC7421 zone)

EMBL: CP001389.PE499

CP001389.PE499       Location/Qualifiers
FT   CDS_pept        563333..564532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24303"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH5"
FT                   /protein_id="ACP24303.1"
FT                   /translation="MTIRLSNRDARRIFLAKQGLSAAPHRALGKDGLLRLIHDIGFVQV
FT                   DSISTVARAHHQILFSRNQTYRREHLSELLEEDGDLFEHWTHDASIIPSAFFVYWKHRF
FT                   KWESETLRERWRRWRGEGFDASCDETYERIASGGAVMARELKEDHHESGGWWNWHPSKT
FT                   ALEVLWRQGRLAIARRVNFQKVYDLTERVIPAHHYEGDVSHPEFIDWACRSALGRLGFA
FT                   THGEIAAFWDLASPEEAKAWVAEHRDELCEILVEPANGGKPRPSYAFTGFPDNLGDVPD
FT                   PPARIRVLSPFDPLLRDRNRTERLFGFFYRIEVFVPEAKREYGYYVFPLLEGDRLIGRI
FT                   DMKADRKRGSLEVRRLWLEEGIKPSSGRIDKVMAELDRIARFAGVGGVNLLEGWNAGLA
FT                   "
     atgacgattc gtctctccaa tcgcgatgcc cggcgcatct ttctcgccaa gcagggtctc        60
     tctgccgcgc cgcatcgtgc gctgggcaag gatggcctgc tgcggctgat ccacgacatc       120
     ggcttcgtac aggtcgacag catctcgacc gtcgcgcggg ctcatcacca gatcctgttt       180
     tcgcgcaacc agacctatcg ccgcgagcat ttgagcgagc tcctcgaaga ggacggtgac       240
     ctcttcgaac actggaccca cgacgcttcg atcattccga gtgccttctt cgtctattgg       300
     aagcatcgct tcaaatggga gagcgaaacg ctgagagagc gctggcgcag gtggcgcggc       360
     gaggggtttg acgcgagttg cgacgaaacc tatgaacgga tcgccagcgg cggagcggtg       420
     atggcgcgag agctgaagga agaccatcac gaatccggcg gctggtggaa ctggcacccg       480
     tcgaagacgg cgctcgaagt gctctggcgg caggggcggc tggcgatcgc tcgccgcgtc       540
     aacttccaga aggtctacga cctgacggag cgggtgatcc cggctcatca ctatgaaggc       600
     gatgttagcc atccggagtt tatcgattgg gcctgccgca gcgccctcgg acgcctcggc       660
     tttgcaacgc acggggagat cgccgccttt tgggacctcg cctcgcccga ggaagccaag       720
     gcctgggtcg cagaacatcg cgacgagctt tgcgaaattc tcgtcgagcc tgccaacggc       780
     ggcaagccgc ggccgtccta tgcttttacg ggctttccgg acaacctcgg cgacgttccg       840
     gatccgccgg cccgcattcg tgtcctgagc cccttcgatc ctttgctgcg cgaccgcaac       900
     cgcaccgaac ggctgttcgg cttcttttac cgaatcgagg tttttgtccc cgaggcgaag       960
     cgtgaatatg gctactacgt ctttccgctt ctcgaaggtg atcggctgat cggccggatc      1020
     gacatgaagg cggatcgcaa gcgcggcagc ctggaggttc ggcggctctg gctcgaagag      1080
     ggcatcaagc cgtcgtcggg ccgcatcgac aaggtgatgg ccgaactcga ccggatcgcc      1140
     cgcttcgccg gcgtcggagg cgtcaatctg ctcgagggct ggaacgccgg cctcgcctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page